KEGG   Bos taurus (cow): 541148
Entry
541148            CDS       T01008                                 

Gene name
PTX3
Definition
(RefSeq) pentraxin-related protein PTX3 precursor
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: Pentaxin Laminin_G_3
Other DBs
NCBI-GeneID: 541148
NCBI-ProteinID: NP_001069727
BGD-bta: BT10420
Ensembl: ENSBTAG00000009012
VGNC: 33566
UniProt: Q0VCG9
Position
1
AA seq 382 aa
MHISVILFCALWSAVSAENSDDYELMYVNLDNEIDNGLHPTEDPTPCDCSRENSEWDKLF
TMLENSQMREGMLLQATDVMLRGELQKLQAELGRLEGSLQKLCGPEAPSETRLARALDDL
LQASRDAGRRLARLEDAGALRPQEEAGRALGAVLEELRRTRADLRAVQGWAASRWLPAGC
ETAILFPMRSKKIFASVHPVTPMKLETFSACIWVKATEVLNKTVLFSYGTKRNPYEIQLY
LSYRSIMLVVGGEENRLVADAVISLGTWTHLCSTWDSKKGHMALWVNGDSVATAVDMATG
HVVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWEGVLSNEEIREAGGAESCHI
RGNVVGWGVTEIQPHGGAQYVY
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcatatctctgtgattctgttttgtgcgctctggtctgcagtgtcggcggagaactca
gatgattatgagctcatgtatgtgaatttggacaacgaaatagacaatggactccatccc
actgaggaccccacgccgtgcgactgcagtcgtgagaactccgagtgggacaagctcttc
accatgctggagaactcgcagatgcgggagggcatgctgctgcaggccaccgacgtcatg
ctccggggcgagctgcagaagctgcaggccgagctgggccggctggagggaagcctgcag
aagctgtgcgggccggaggccccctccgagaccaggctggcccgggcgctggacgacctg
ctgcaggcgagccgcgatgctggccgccggctggcgcgcctggaagatgctggggcgctg
cgaccgcaggaggaggcggggcgggccctgggcgcggtgctggaggagctgcggcggacg
cgggccgatctccgagctgtgcagggctgggcagccagccgctggctgccggcaggttgt
gaaacagccattttattccccatgcgttccaagaagatttttgcaagcgtgcatccggtg
acaccaatgaaactcgagactttcagtgcctgcatttgggtcaaagccacagaagtatta
aacaaaacagtcctgttttcttatggcacaaagaggaatccatatgagatccagctgtac
ctcagctatcggtccataatgcttgtggtgggtggagaggaaaacagactggtcgctgat
gctgtgatttccctaggaacgtggacccatctgtgcagcacctgggattcaaagaaaggg
cacatggccttgtgggtaaatggtgactcggtggccactgctgttgatatggccacaggt
catgttgttcctgaggggggaatcctgcagattgggcaagaaaagaacggctgctgcgtg
ggtggtggctttgatgaaacattagccttctctggcagactcacaggcttcaatatctgg
gagggtgttctcagtaacgaagagataagagaggccggaggagcagagtcctgtcacatc
cggggcaatgtggttgggtggggagtcacagagattcagccccacggaggagcacagtat
gtttattaa

DBGET integrated database retrieval system