KEGG   Bos taurus (cow): 541205Help
Entry
541205            CDS       T01008                                 

Gene name
THNSL2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    541205 (THNSL2)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     541205 (THNSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 541205
NCBI-ProteinID: NP_001179773
BGD-bta: BT12700
Ensembl: ENSBTAG00000004364
VGNC: 35839
UniProt: E1B913
Position
11
AA seq 484 aa AA seqDB search
MWYVSTRGMAPRIDFEEALFSGYAPDGGLYMPEELPQLGRETLHEWSTLSYPSLVKELCS
LFIGPELIPRDDLNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLCCT
AQFLQYFLEKRKRHITVVVGTSGDTGSAAIESVQGAKNVDIIVLLPKGHCTKIQELQMTT
VLRENVHVFGVEGNSDELDEPIKTVFADMAFVKKHNLMSLNSINWSRVLVQIAHHFFAYF
RCAPSLDMHPLPPVEVVVPTGAAGNLAAGCIAQKMGLPIHLVVAVNSNDIIHRTVQWGDF
SLSKAVKPTLASAMDIQVPYNMERIFWLLSSSDSQVIRALMEQFERTKSVSLPKELHSKL
LEAVTSQSVSDEAITQTMGRCWQENQYLLCPHSAVAVSCHYQQVDRQQPSPPRCCLAPAS
AAKFPEAVRAARLTVDTPAEILALEHKEARCTPMRKGDDWTRMLRDTIEDLSQQWQRRFL
NLPA
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatgtcagcactcggggtatggccccacggattgacttcgaggaggcgctcttc
tctggctatgctccagacgggggcctctacatgcctgaggagcttccacagctgggcaga
gagaccctgcatgagtggagcacactctcctaccccagcttggtgaaggagctgtgcagc
ctcttcattggacctgagctcattcctagagatgacctaaatgatctgattgatcgtgcc
ttcagcagattccgccacagagaggtggtgcatctgtccaggttgaggaatgggctgaac
gtgctggagctgtggcacggggtcacctatgcgtttaaggacctgtccctgtgctgcaca
gcacagttcctgcagtacttcctggagaagaggaagaggcacatcaccgtggttgtagga
acttctggagacacaggaagtgctgccattgagagtgttcagggggcaaaaaacgtggac
atcattgttctgctgcccaagggtcactgtacaaagattcaggagctccagatgacaaca
gtgctaagagagaacgtccacgtgttcggagtagagggtaacagcgatgagctggatgag
cccatcaagacggtgtttgccgacatggcctttgtcaagaagcacaacctaatgagtctg
aattcaatcaactggtcccgggtcctcgtgcaaatagcccaccacttctttgcttacttc
cggtgtgcgccatccttagacatgcaccccctgccccccgtggaggtggttgtgccaaca
ggggctgccggtaaccttgcagctgggtgcatcgctcagaagatggggctgcccattcac
ctggtcgtggcagtgaacagcaatgacatcatccacaggaccgtccaatggggagacttc
tctctgtccaaagcggtcaagccaaccttggcgtcggccatggacattcaggttccctac
aacatggagaggatcttctggctgctatctagctctgacagccaggtgataagagccctc
atggagcagtttgaaaggacaaaaagtgtgagtctacccaaggagctgcacagcaagctt
ttggaggcagtaacctctcaatcggtgtcggatgaggctatcacccagacgatgggccgc
tgctggcaggagaaccagtacctgttgtgcccgcactcagccgtggccgtgagctgccat
taccagcaggtggacaggcagcagcccagccctccccgctgttgtctggctcctgcctct
gcagccaagttcccggaggctgtgcgggctgccaggctgaccgtggacaccccggcagag
atcctcgccctggagcacaaggaggcacgctgcaccccaatgcggaagggcgatgactgg
acacggatgctccgggacacgattgaggacctgagccagcagtggcagaggcgcttcctg
aatctcccggcatag

DBGET integrated database retrieval system