KEGG   Bos taurus (cow): 541232Help
Entry
541232            CDS       T01008                                 

Gene name
NDUFAF1
Definition
(RefSeq) complex I intermediate-associated protein 30, mitochondrial
  KO
K18159  NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 1
Organism
bta  Bos taurus (cow)
Pathway
bta04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    541232 (NDUFAF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    541232 (NDUFAF1)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-I assembly factors
    541232 (NDUFAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CIA30 CBM_11
Motif
Other DBs
NCBI-GeneID: 541232
NCBI-ProteinID: NP_001193003
BGD-bta: BT19445
Ensembl: ENSBTAG00000010778
VGNC: 31953
UniProt: E1BAZ2
Position
10
AA seq 328 aa AA seqDB search
MALVHKLLNGTYILRKCPKPRVASFPFLGTRFADYCSNSFQKPVAAPGKASSQRKTKGNL
EEHHQREVALEITSPEDKPEISFDKAIKEEMKDHFRRLKDDIVKYWIGPEGRPLHEVLME
QAKVVWQFRSKEDLDKWTVTSDKVIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESGR
SGYCAMVSKIPRGPFEMKRSYDWSQFNTLYLRVRGDGRPWMVNIREDTDIIQKKDQMYSY
FMFTRGGPYWQEVKIPFSKFFFSNQGRIRDAQYQLLLDKISSIGFTLADKVDGPFFLEID
FIGVFTDPAHTEEFAYENSPELNPRLFK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggctttggttcataaattgttgaatggcacttatattctcagaaaatgcccgaagcca
agagttgcctcttttccatttttggggactcgctttgcagactattgttccaatagtttt
cagaaaccagtggctgctcctggcaaagcctcttctcagaggaagactaaagggaatttg
gaagaacatcaccagagagaagttgctttggaaataacttctcctgaggacaagcctgaa
attagttttgataaagcaattaaagaagaaatgaaggaccattttaggcgtttgaaggat
gatattgtgaaatattggatagggcctgaaggccgccctctgcatgaggtcttgatggaa
caagccaaggttgtctggcaattccgtagcaaagaagatttggataagtggacagtaact
tctgataaagtgattggtggcagaagtgaagtgttcctgaaaatgggcaagaataaccaa
agtgcgctgctgtatggaactctgagctccgaggcgccccaggatggggaaagtggccga
agtgggtactgtgctatggtatccaagattccaaggggcccttttgaaatgaagagatct
tacgattggtcccagttcaacactctgtatctccgtgtccgtggagatggtcgaccttgg
atggtgaatatcagggaggacacagatataatccagaagaaggatcagatgtacagttac
ttcatgttcacccgtggggggccctactggcaggaggtcaagattcctttctccaaattt
ttcttctctaatcaaggaagaatccgggatgcccagtaccagcttctgctcgacaagatt
tcatctattggattcaccctggctgataaagtggatggtccattcttcttggaaatagat
tttattggagtatttacagatcccgcccacacagaagaatttgcctatgagaattctcca
gagcttaatccaagactttttaaatag

DBGET integrated database retrieval system