KEGG   Bos taurus (cow): 541306
Entry
541306            CDS       T01008                                 

Gene name
AFF4
Definition
(RefSeq) AF4/FMR2 family member 4
  KO
K15185  AF4/FMR2 family member 4
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bta03021]
    541306 (AFF4)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     541306 (AFF4)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 541306
NCBI-ProteinID: NP_001178058
BGD-bta: BT13233
Ensembl: ENSBTAG00000009482
VGNC: 25712
UniProt: E1BCF6
Position
7
AA seq 1164 aa
MNREDRNVLRMKERERRNQEIQQGDDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYD
EMKDFIGDRSIPKLVAIPKPTVPPTADEKSNPNFFEQRHGSSHQSSKWTPVGPAPSTSQS
QKRSSGLQSGHSSQRASAGASGGTNSSGQRHDRDSYSSGGSSSRKKGQHGSEHSKSRSSS
PGKPQAVSSLSSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRVPFSSGQHSNQSFPP
SLMSKSSSMLQKPTAYVRPMDGQESMEPKLSSEHYSSQSHGNSMTELKPSSKAHLTKLKI
PSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSSFGPG
EQKRYNPSSKTSNAHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSE
GADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLN
KVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDPGGPKETSSATPGRDSKTVQKG
SESGRGRQKSPAQSDSTAQRRTVGKKQPKKTEKAAAEEPRGGLKIESETPVDMATSMPSS
RHKAATKGSRKPNIKKESKSSPRPSAEKKKYKSTSKSSQKSREIIETDTSSSDSDESESL
PPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKID
LNLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRANES
KKPKTEDKNMAGHKPSSNKESSKQSASKEKDLLPSPAGPVPSKDPKTEHGSRKRTVSQSS
SLKSSNNSNKENSASSKNSSSASKQKRTEGKTSSSSKEVKEKAPNSSSNCPPSAPTPDAS
KPRRTKLAFDDRNYSADHYLQEAKKLKHNADALSDRFEKAVYYLDAVVSFIECGNALEKN
AQESKSPFLMYSETVELIKYTMKLKNYLAPDATAADKRLTVLCLRCQSLLYLRLFKLKKE
TALKYSKTLTEHLKNSYNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNYSSGASSASAS
GSSVTIPQRIHHMAASYVQVTSNFLYATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNAS
IMTDLVRYTRQGLHWLRQDAKLIS
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgaaccgtgaagaccggaatgtgctgcgtatgaaagaacgggaaaggcggaatcaggaa
attcagcagggcgacgacgccttcccacctagctctcctctctttgctgagccatacaaa
gttactagcaaagaagataagctgtcaagtcgtattcagagtatgcttggaaactacgat
gaaatgaaggatttcataggagacagatctataccaaagcttgttgcaattcccaagcct
acagtaccgccgacagcagatgaaaaatctaacccaaatttctttgaacagagacatggg
agctctcatcagagtagcaaatggactccagtaggacctgcacccagcacttctcagtct
cagaaaaggtcctcgggcttacagagtggacacagtagccagcgggccagtgcaggtgcc
agtggtggcactaatagtagtggccagagacatgaccgtgactcatacagcagtggtggg
agcagtagccgaaaaaaaggccagcatggatcagaacactccaaatcacgctcttccagc
cctggaaaaccccaggctgtttcttcattaagctccagtcattccaggtctcatgggaat
gatcaccatagcaaagaacatcagcgttccaaatcacctcgggaccctgatgcaaactgg
gattctccttcccgtgtacctttttcaagtgggcagcactcaaatcagtctttcccacct
tcattgatgtcaaagtccagctcaatgctacagaaacccactgcctatgtgcggcccatg
gatggacaggagtccatggaaccaaagctgtcctctgaacactacagcagccagtctcat
ggcaacagcatgactgaactgaagcccagcagtaaagcacatctcaccaagctgaaaata
ccttcccaaccattggatgcatctgcttctggggatgtgagttgtgtggatgaaattctt
aaagagatgacgcattcatggcctccccctctaacggctattcatacaccatgcaaaaca
gaaccttccaaatttccttttccaactaaggagtctcagcagtccagttttggccctgga
gaacaaaaaagatataatccttcttctaaaacttcaaatgcacaccagtctaaatctatg
ttaaaagatgacttaaagctaagcagcagtgaagacagtgatggagaacaggattgtgat
aagacaatgccaaggagtacaccaggaagtaactctgaaccttcacaccataatagtgaa
ggggcagataactccagggatgattctagcagccacagtggatctgaaagcagctctgga
tctgactcagagagtgaaagtagttccagtgacagtgaggcaaatgagccatcccagagt
gcatctcctgagcctgaaccacctcccacaaataaatggcaacttgataactggctgaat
aaagtaaatccacataaagtatcaccagcttcttctgtggacagtaatatcccatcatct
caaggctataaaaaggaaggccgagaacagggcacagggaatagctacacagatccaggt
ggtcctaaagaaacaagttctgctactcctggacgagactccaaaactgtccaaaaggga
tcagaaagtgggcgtgggaggcaaaagtctcctgcccagagtgacagcacagcacagagg
agaactgtagggaaaaaacaacccaaaaagactgagaaggcagctgctgaagagccccgt
ggaggcctgaagatagagagtgaaactcctgtagacatggctaccagcatgccctccagc
agacacaaagcggccaccaaaggctcaagaaaacccaatataaaaaaggagtccaaatct
tcccctcgaccttcagcagagaaaaagaaatacaagtcaacaagtaaatcttcccagaaa
tcaagggaaattatagaaacagatacctcatcctcagattcggatgaaagcgagagcctt
cctccttcctcacaaactcctaagtaccctgagagtaataggactcccgttaaaccctcc
tcagtggaggaagaagatagcttttttcggcaacgaatgttctctcctatggaagagaag
gaacttctttcacccctcagtgagcctgatgacaggtatccacttattgtgaagattgac
ctgaatctcttgactagaataccaggaaagccttacaaagaaacagagccacccaagggg
gaaaagaaaaatgtgccagaaaagcacacaagagaggctcagaaacaagcctcagagaaa
gtttccaacaaaggcaagaggaaacataagaatgaagatgataaccgagccaatgaaagc
aagaaacctaaaacagaggacaagaatatggcaggccacaagccatccagcaacaaagag
tcatctaaacagagtgcttctaaagaaaaagatttattgccttctcctgctgggcctgtt
ccttcaaaagatccaaaaacagagcatggctctcggaagaggactgttagtcagtcttct
tccttaaagtcaagtaataacagcaacaaggaaaatagtgccagcagcaaaaacagttcc
tccgcatcaaagcagaagaggactgaagggaagacttccagtagctctaaggaggtcaag
gaaaaagctccaaatagttcttctaactgtcctccatctgcaccaactcctgatgcttct
aagcctcggagaacgaagcttgcctttgatgacagaaattattcagcagaccattattta
caagaagcaaaaaagctaaagcacaatgcagatgcattgtctgataggtttgagaaagct
gtatactatcttgatgctgtggtatctttcattgaatgtgggaatgcattagagaaaaat
gctcaggaatccaaatccccattccttatgtattcagaaacggtggagctcatcaaatac
actatgaagctaaagaattacttggcaccagatgctacagctgcagataaaagacttaca
gtgctttgcctgcgatgccagtctttgctgtacctgaggctcttcaaactgaagaaagaa
actgctctgaagtattcaaagacactgacagagcatctgaagaattcttacaataactct
caagcaccatcaccaggcttgggaagcaaagctgttgggatgccttcccctgtttctcca
aagctgtcaccaggcaattcaggaaattattcttctggagccagtagtgcttcagcaagt
ggttcttcagtgaccattccacagaggattcaccacatggcagccagctatgttcaggtt
acatccaacttcctctatgccactgaaatttgggaccaagctgaacagctttccaaagag
caaaaagaattctttgctgaactggataaagtaatgggccctctcatctttaatgcaagc
atcatgacagacctagttcgttacacccggcagggactgcactggcttcgccaggatgcc
aagttgatatcctga

DBGET integrated database retrieval system