KEGG   Bos taurus (cow): 613384Help
Entry
613384            CDS       T01008                                 

Gene name
CD74
Definition
(RefSeq) HLA class II histocompatibility antigen gamma chain
  KO
K06505  CD74 antigen
Organism
bta  Bos taurus (cow)
Pathway
bta04612  Antigen processing and presentation
bta05152  Tuberculosis
bta05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    613384 (CD74)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    613384 (CD74)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    613384 (CD74)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bta04090]
    613384 (CD74)
   00535 Proteoglycans [BR:bta00535]
    613384 (CD74)
CD molecules [BR:bta04090]
 Proteins
  613384 (CD74)
Proteoglycans [BR:bta00535]
 Cell surface proteoglycans
  Others
   613384 (CD74)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC2-interact MHCassoc_trimer
Motif
Other DBs
NCBI-GeneID: 613384
NCBI-ProteinID: NP_001029907
BGD-bta: BT17580
Ensembl: ENSBTAG00000015228
VGNC: 52227
UniProt: Q29630
Position
7
AA seq 204 aa AA seqDB search
MEDQRDLISNHEQLPMLGQRPGAQESKCSRGALYTGFSVLVALLLAGQATTAYFLYQQQG
RLDKLTVTSQNLQLENLRMKLPKPAKPMSQMRMATPMLMRALPMAGPEPMKNATKYGNMT
QDHVMHLLLKADPLKVYPQLKGSLPENLKHLKDSMDGLDWKLFESWLHQWLLFEMSKNSL
EEKPFEGPPKDPMEMEYPSSGLGV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaagaccagcgtgacctcatctccaaccatgagcagctgcccatgctgggccagcgc
cccggagcccaggagagcaagtgcagtcgtggagccctgtacacgggcttttccgtcttg
gtggctctgctcctggctggccaggccaccactgcctacttcctgtaccagcagcagggc
cggctggacaagctgacggtcacctcccagaacctgcagctggagaacctgcgcatgaag
cttcccaagcctgccaagcctatgagccagatgcggatggccactcccatgctgatgcgg
gcgctgcccatggcaggcccagagcccatgaagaacgccaccaagtacggcaacatgaca
caggaccacgtgatgcacctgctcctgaaggcagaccccctgaaggtgtacccgcagctg
aaggggagcctgccagaaaacctgaaacaccttaaggactccatggatggcttggactgg
aagctctttgagagctggctgcatcagtggctcttgtttgaaatgagcaagaactcgctg
gaggagaagccctttgagggtccaccaaaagacccaatggagatggagtatccgtcatct
gggctgggggtgtaa

DBGET integrated database retrieval system