KEGG   Bos taurus (cow): 613610Help
Entry
613610            CDS       T01008                                 

Gene name
PDHB
Definition
(RefSeq) pyruvate dehydrogenase E1 component subunit beta, mitochondrial precursor
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00020  Citrate cycle (TCA cycle)
bta00620  Pyruvate metabolism
bta01100  Metabolic pathways
bta01200  Carbon metabolism
bta04066  HIF-1 signaling pathway
bta04922  Glucagon signaling pathway
bta05230  Central carbon metabolism in cancer
Module
bta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    613610 (PDHB)
   00020 Citrate cycle (TCA cycle)
    613610 (PDHB)
   00620 Pyruvate metabolism
    613610 (PDHB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    613610 (PDHB)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    613610 (PDHB)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    613610 (PDHB)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     613610 (PDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr Transketolase_C
Motif
Other DBs
NCBI-GeneID: 613610
NCBI-ProteinID: NP_001030512
BGD-bta: BT14411
Ensembl: ENSBTAG00000021724
VGNC: 49151
UniProt: P11966
Position
22
AA seq 359 aa AA seqDB search
MAVVAVLVRKPLEQVSGLLRRRFHRTAPAALQVTVREAINQGMDEELERDEKVFLLGEEV
AQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAI
DQVINSAAKTYYMSGGLQSVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWSS
EDAKGLIKSAIRDNNPVVVLENELMYGVPFELPSEAQSKDFLIPIGKAKIERQGTHVTIV
AHSRPVGHCLEAATVLSKEGIECEVINLRTIRPMDIETIEGSVMKTNHLVTVEGGWPQFG
VGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSVPQVKDIIFAIKKTLNI
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggttgctgtgttggtgcggaaaccccttgagcaggtctccgggctgctgagg
aggcggttccaccggaccgcgccggctgcactgcaggtgacagttcgtgaggctataaat
caaggcatggatgaggagctggaaagagatgagaaggtatttctccttggggaagaagtt
gcccagtacgatggggcatataaggttagtcgaggcctgtggaagaaatatggagataag
aggatcatagatactcccatatctgagatgggctttgctggaattgctgtaggtgccgct
atggctgggttacggcccatttgtgaattcatgaccttcaatttctctatgcaagccatc
gaccaggtcataaactcagctgccaagacgtactacatgtcagggggccttcagtctgtg
cccatagtcttcagggggcccaatggcgcctcagcaggtgtagctgcccagcactcacag
tgttttgctgcctggtatgggcattgcccaggcttaaaggtggtcagcccctggagttca
gaggatgcaaaagggcttattaaatcagccattcgggataacaacccagtggtggtgctg
gagaatgaattgatgtacggagtaccttttgaacttccttcagaagctcagtcaaaagat
tttctgatccctattggaaaagccaaaatagaaaggcaaggaacacacgtaactatagtt
gctcattcaagacctgtgggccactgcttagaagctgcaacagtactgtctaaagaggga
attgaatgtgaggtgataaatttgcgaaccatcaggccaatggacattgaaacaatagaa
ggcagtgtcatgaagaccaatcaccttgtaaccgtggaaggaggctggccacagttcgga
gtaggagctgaaatctgtgccaggatcatggaaggccccgcgttcaatttcctggatgct
cctgcagttcgcgtcactggtgccgatgtgcctatgccttatgcaaagattctagaagac
aactctgtacctcaggttaaggacatcatatttgcaataaagaaaacactgaatatctag

DBGET integrated database retrieval system