KEGG   Bos taurus (cow): 613629
Entry
613629            CDS       T01008                                 

Gene name
SIRT1
Definition
(RefSeq) NAD-dependent protein deacetylase sirtuin-1
  KO
K11411  NAD+-dependent protein deacetylase sirtuin 1 [EC:2.3.1.286]
Organism
bta  Bos taurus (cow)
Pathway
bta00760  Nicotinate and nicotinamide metabolism
bta01100  Metabolic pathways
bta04068  FoxO signaling pathway
bta04152  AMPK signaling pathway
bta04211  Longevity regulating pathway
bta04213  Longevity regulating pathway - multiple species
bta04218  Cellular senescence
bta04922  Glucagon signaling pathway
bta05031  Amphetamine addiction
bta05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    613629 (SIRT1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    613629 (SIRT1)
   04152 AMPK signaling pathway
    613629 (SIRT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    613629 (SIRT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    613629 (SIRT1)
  09149 Aging
   04211 Longevity regulating pathway
    613629 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    613629 (SIRT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    613629 (SIRT1)
  09165 Substance dependence
   05031 Amphetamine addiction
    613629 (SIRT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    613629 (SIRT1)
   03029 Mitochondrial biogenesis [BR:bta03029]
    613629 (SIRT1)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     613629 (SIRT1)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     613629 (SIRT1)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    613629 (SIRT1)
SSDB
Motif
Pfam: SIR2 DUF592
Other DBs
NCBI-GeneID: 613629
NCBI-ProteinID: NP_001179909
BGD-bta: BT25961
Ensembl: ENSBTAG00000014023
VGNC: 34630
UniProt: F1MQB8
Position
28
AA seq 734 aa
MADEAALALQPGGSPSVVAAEREAPSPPAGEPLRKRPRRDGPGVGRSSGEPGGTAPEREL
PAAAGSCPAAAAALWREAQAAAAAAAEEEDNGPGLQGLSREAPPADDFYDDDDEGEEKEE
AAAAIGYRDNLLFGDEIITNGFHSCESDEDDRASHASSSDWTPRPRIGPYTFVQQHLMIG
TDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKK
IIVLTGAGVSVSCGIPDFRSRDGIYARLAIDFPDLPDPQAMFDIEYFRKDPRPFFKFAKE
IYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQKIIQCHGSFATASCLICK
YKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDL
LIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGG
EYAKLCCNPVKLSEITEKPPRIQKELAHLSELPPTPLNISEGSSSPERTSPPDSSVIVTL
LDQETKSNVDDPDVSESKDHVTEKSQEVQTSTRSIESVNEQLESPDLKNAVSNSGEKNER
TSVAETVRKCWPARLAKEQISKRLDDNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGS
NSDSGTCQSPSLEEPMEDESENEEFYNGLEDDADVNERAGGTVFEADGGDQEAINEAISV
KQEATCINYPSNKS
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggcggacgaggcggcgctcgcccttcagcccggcggctctccctcggtagtggcggct
gagagggaggccccgtcgccgcctgctggggagccgctccgcaagaggccgcgaagagac
ggccccggcgtcgggcggagctcgggcgagcccggtgggacggcccccgagcgggaactg
ccggcggcggccggcagttgcccggcggcggcggcggcgctgtggcgggaggcccaggcg
gcggcggcggcggcggccgaagaagaagacaatgggccgggcttacagggcctatccagg
gaggcgccaccggccgacgacttctacgacgacgacgacgagggcgaggagaaggaagag
gcggcggccgctattgggtaccgagataaccttctgtttggtgatgaaatcatcaccaac
ggtttccattcgtgtgaaagtgacgaagatgatagagcctcgcatgcgagttctagtgac
tggactccaagacctcggataggtccatatacttttgttcagcaacatctcatgattggc
acagatcctcgaacaattcttaaagatttactaccagaaacaattcctccacctgaattg
gatgatatgacactgtggcagattgttattaatatcctttcagaaccaccaaaaaggaaa
aaaagaaaagatattaatacaattgaagatgctgtgaaattactgcaagagtgcaaaaaa
ataatagttctaactggagctggggtttctgtttcttgtggaatacctgacttcaggtca
agagacggtatttatgctcgccttgcaatagactttccagaccttccagatcctcaagca
atgtttgatattgaatatttcagaaaagacccaagaccattcttcaagtttgcaaaggaa
atatatcctggacaattccaaccatctctttgtcacaaattcatagccttgtctgataag
gaaggaaaactacttcgcaactatactcagaacatagatacactggagcaggttgcagga
atccaaaagataattcagtgtcatggttcctttgcaacagcatcttgcctgatttgtaaa
tataaagttgactgtgaagctgtacgaggagatatttttaatcaggtggttcctcgatgt
cctagatgcccagctgatgaaccgcttgctatcatgaaaccagaaattgtcttttttggt
gaaaatttaccagaacagtttcatagagccatgaagtatgacaaagatgaagttgatctt
ctcattgttattggatcttccctgaaagtaagaccagtagcactaattccaagttccata
ccccatgaagtgcctcagatattaattaatagggaacctttgcctcacctgcattttgat
gtagagcttcttggagactgtgacgtaattattaatgaactgtgtcataggttaggtggt
gaatatgccaaactttgctgtaaccctgtgaagctttcagaaattactgaaaaacctcct
cgaatacaaaaagagttggcacatttgtcagaattgccacccacacccctcaatatttca
gaaggctcaagttcaccagaaagaacttcaccaccagattcttcagtgattgtcactctt
ttagaccaagaaacaaagagtaacgttgatgatccagatgtgtctgaatcaaaagaccat
gtcacagaaaaatcacaggaagtacagacttctactaggagcattgaaagtgttaatgaa
cagttggagagtccagatttgaagaatgctgtctccaattctggtgagaaaaatgaaaga
acttcagtagctgaaacagtgagaaaatgctggccagctagacttgcaaaggagcagatt
agtaaacgccttgatgataatcagtatctgtttttaccaccaaaccgttacattttccat
ggcgctgaggtatattcagactctgaagatgatgtcttatcctctagttcttgcggcagt
aacagtgatagtggaacgtgccagagtccaagtttagaagaacccatggaggatgaaagt
gagaatgaagaattttacaatggtttggaagatgatgctgatgttaatgagagagctgga
ggaactgtatttgaagctgatggaggtgatcaagaggcaattaatgaagctatatctgtg
aaacaggaagcaacatgcattaactatccatcaaacaaatcataa

DBGET integrated database retrieval system