KEGG   Bos taurus (cow): 613653
Entry
613653            CDS       T01008                                 

Gene name
ITPA
Definition
(RefSeq) inosine triphosphate pyrophosphatase
  KO
K01519  inosine triphosphate pyrophosphatase [EC:3.6.1.-]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta00983  Drug metabolism - other enzymes
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    613653 (ITPA)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    613653 (ITPA)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     613653 (ITPA)
SSDB
Motif
Pfam: Ham1p_like
Other DBs
NCBI-GeneID: 613653
NCBI-ProteinID: NP_001069750
BGD-bta: BT13292
Ensembl: ENSBTAG00000013776
VGNC: 30342
UniProt: Q2KIC5
Position
13
AA seq 208 aa
MAASLAGKKIVFVTGNAKKLEEVIQILGDKFPCTLVAQKIDLPEYQGEPDEISIRKCQEA
ARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLEKLKPEGLHQLLEGFQDKSAYALCTFAF
STGDPNEPVRLFRGRTMGRIVVPRGCRDFGWDPCFQPDGYEQTYAEMPKAEKNTISHRFR
ALLALQEYFSSLTPGVGDDHPSWGSGEG
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcggcctccttggccgggaagaagatcgtgtttgtcacggggaacgccaaaaagctg
gaggaggtcattcagattctaggagataaatttccgtgtactttggtggcgcagaaaatt
gacctgccagagtaccaaggagagcctgatgagatttccattcggaagtgtcaggaggca
gctcgccaggtgcagggccctgtactggtagaggacacctgtctgtgcttcaacgccctt
ggaggcctccctggcccctacataaagtggtttctggagaagttaaagcctgaaggtctc
caccagctcctggaggggttccaagacaagtctgcctatgcactctgcacgttcgcattc
agcactggggacccgaatgagcccgtacgcctcttcaggggccggacaatgggccggatt
gtggtgccccgtggctgccgggactttggctgggacccctgctttcagcctgatggatac
gagcagacgtatgcagagatgcccaaggctgagaagaacaccatttcccatcgcttccgg
gccctgcttgcgttgcaagaatattttagcagcctgactcctggggtcggtgatgaccac
cctagctggggatccggagaggggtag

DBGET integrated database retrieval system