KEGG   Bos taurus (cow): 613849Help
Entry
613849            CDS       T01008                                 

Gene name
COL13A1
Definition
(RefSeq) collagen alpha-1(XIII) chain
  KO
K16617  collagen, type XIII, alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    613849 (COL13A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    613849 (COL13A1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   613849 (COL13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen
Motif
Other DBs
NCBI-GeneID: 613849
NCBI-ProteinID: NP_001098903
Ensembl: ENSBTAG00000011741
VGNC: 27555
UniProt: A7YY40
Position
28
AA seq 686 aa AA seqDB search
MVAERSRKATAAGARGPAELDAPGTVALAVAPAERCARLPSPGSCGLLALALCSLALSLL
AHFRTVELQARVLRLEAERGEQQMEPAILGRVNQLLDEKWKLHSRRRRETLKTSPGCHCP
PGPPGPAGRPGLPGDKGAIGMPGRVGGKGQPGEKGAPGDAGMSIIGPRGPPGQPGTRGFP
GFPGPIGLDGKPGRPGPKGEMGPQGQKGEKGQCGEYPHRGEQGQAGIQGPPGPPGPPGPS
GPLGHPGLPGPMGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGTKGEPGIPGAK
GEKGAAGSPGPLGLLGQKGEKGDAGNSIEGGRGEPGLPGPPGPPGPKGEAGADGQPGPPG
EQGDKGEPGPAGEQGPTGPKGSKGETGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQI
GPPGAPGIPGEKGEIGLPGPPGLDGEKGPRGKPGDVGPPGPQGPPGKPGPAGMKGEDGLP
GSPGEKGEKGETGQPGPPGLDGPTGEKGEPGDQGRPGATGLPGPIGLPGFIGEKGEPGEK
GDPGMEVPGPPGPEGPPGPPGLQGVPGPKGEAGLDGAKGDKGVQGEKGDRGPLGLPGTPG
PIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKG
DQGAPGLDAPCPLGEDGLPVQGCWNK
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggtagcggagcgctcccgcaaagcgacagccgccggtgcccgcggccctgcggagctg
gacgcacccgggacagtggcgctggcggtggcgccggcggagcgctgcgcgcggctgccg
agcccggggtcgtgcgggctgctggcgctggccctctgctcgctggcgctcagcctgctc
gcccactttcggacggtcgagctgcaggcccgggtgctgcgcctggaagcggagcgtggg
gagcagcaaatggagccggctattttgggacgagtcaaccaactgctggatgagaaatgg
aagctccactcacggaggcgccgggagaccctgaagacatccccaggatgtcactgcccg
ccagggcctcctggtcctgctggaagacccggcctccccggggacaaaggtgccattggg
atgcctggacgtgtgggaggaaagggccaaccaggcgagaagggcgccccaggagatgcc
ggcatgtccatcattggtccccgcggcccccctggtcagccgggcacccggggttttcca
ggatttccgggtcccattgggctcgacggcaaaccgggccggccgggaccaaagggggag
atgggacctcaaggacaaaagggagaaaagggtcagtgtggcgagtacccacaccggggt
gaacagggccaggctggcatccaaggcccaccagggccaccaggccctcccggaccgagt
ggacctctggggcacccaggactgccagggcccatggggccaccaggcttacctgggcct
cctggaccaaagggagacccagggatccagggctaccacggccggaagggagaacgggga
atgccagggatgccgggcaaacatggaacaaagggtgaacctgggatcccaggagccaag
ggtgagaagggggctgcggggtcccccgggccactcggcctcttggggcagaagggagaa
aaaggcgatgctggcaactccattgaaggaggcagaggggagcccggtctcccagggcct
cctggacccccagggccaaagggggaagctggagcagatggccagccaggccccccagga
gagcaaggagacaagggggagcctggaccagctggagaacagggacctactggccccaag
ggctccaagggcgaaactgggaaaggagagatggtggactacaacggcaacatcaacgag
gctctccaggagatccggacactggccttgatggggccccctggtcttcctgggcagatc
ggcccacccggagctccagggatcccaggcgagaagggggagattggactgccaggccct
cctggactcgatggggaaaagggacctcgaggcaaaccaggagatgtgggccctcctggt
ccccaaggccccccaggaaagcctgggcctgcaggaatgaagggagaagacggcctcccg
gggagcccaggagagaagggggagaaaggggagacggggcagccgggaccaccgggtcta
gacggcccaactggggagaaaggagaaccaggtgaccaagggagacccggagcgactgga
cttcctggcccaatcgggctcccaggatttataggagagaaaggagaaccaggggagaag
ggtgacccaggaatggaggttcctgggccaccagggccagaggggcctcctggacctccg
gggctccaaggcgttcctggaccaaagggggaagcaggactagacggagcaaaaggagac
aagggcgtccagggagaaaaaggagaccgaggtcctctgggattacccggtactccagga
ccaatcggagttccaggcccagcgggaccaaagggagagaggggcagcaaaggtgaccct
gggatgacaggaccaacgggagcagctgggcttcctggtttacacggaccacccggggac
aaaggaaaccggggggagagggggaagaaaggctctagagggcctaagggggataaggga
gaccaaggagcgcctggattagatgccccctgtccattgggtgaagatggcttgccagtc
cagggctgctggaacaagtga

DBGET integrated database retrieval system