KEGG   Bos taurus (cow): 613932Help
Entry
613932            CDS       T01008                                 

Gene name
PLD3
Definition
(RefSeq) phospholipase D3
  KO
K16860  phospholipase D3/4 [EC:3.1.4.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00564  Glycerophospholipid metabolism
bta00565  Ether lipid metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    613932 (PLD3)
   00565 Ether lipid metabolism
    613932 (PLD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    613932 (PLD3)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     613932 (PLD3)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    613932 (PLD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLDc_3 PLDc_2 PLDc
Motif
Other DBs
NCBI-GeneID: 613932
NCBI-ProteinID: NP_001071509
Ensembl: ENSBTAG00000019150
VGNC: 32997
UniProt: Q2KJJ8
Position
18
AA seq 490 aa AA seqDB search
MKPKLMYQELKVPAEEPASELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLW
EYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLDFPNASTSNPSTSQAWLGLLAGAHSSL
DIASFYWTLTNNDTHTQEASAQQGEEVLRQLQTLAPRGVKVRIAVSKPNGPQPQADLQAL
LQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCL
ARDLTKIFEAYWFLGQAGSSIPSTWPRPYDTRYNQETPMEICLNGTPALAYLASAPPPLC
PSGRTPDLKALLNVVDNARSFIYIAVMNYLPIMEFSHPRRFWPAIDDGLRRAAYERGVKV
RLLISCWGHSDPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADDAQARIPYARVNHNKYM
VTERATYIGTSNWSGSYFTETAGTSLLVTQNGRGGLRSQLEAVFLRDWDSPYSHDLDAAA
DSVGNACRLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctaaactgatgtaccaggagctgaaggtgcctgctgaggaacctgccagcgaa
ctgcccatgaatgagatcgaggcatggaaagctgcagaaaagaaagctcgttgggtcctt
ctggtccttatcctggcagttgtgggcttcggtgccctgatgactcagctgtttctatgg
gaatacggcgacttgcatctctttgggcccaatcagcgcccagccccctgctatgaccct
tgcgaagcagtgctggtggagagcattcccgagggcctggacttccccaatgcctccacg
agcaacccctccaccagccaggcctggctgggcctgctcgctggtgcccacagcagcctg
gacattgcctccttctactggactctcaccaacaatgacacccacactcaggaagcctct
gctcagcagggcgaggaggtcctccggcagctgcagactctggcaccccgaggtgtgaag
gtccgcattgctgtgagcaagcccaatgggccccagccccaggcagacctacaggcgctg
ctacagagcggtgcccaggtccgcatggtggacatgcagaagctgacccatggcgtcctg
cataccaagttctgggtggtggaccagacccacttctacctcggcagtgccaacatggat
tggcgctccctgacccaggtcaaggagctgggtgtggtcatgtacaactgcagctgccta
gctcgagacctgaccaagatcttcgaggcctactggttcctgggccaggcgggcagctcc
atcccatcaacctggccccggccttacgacacccgctacaatcaagagactccaatggaa
atctgcctcaacggaacccctgctctggcctacctggcgagtgcacccccaccgctgtgt
ccgagtggccgcaccccagacttgaaggccctgctcaacgtggtggacaacgcccggagt
ttcatctacatcgcagtcatgaactacctgcccatcatggagttctcccacccacgccgg
ttctggcctgccattgacgacgggctgcggcgggctgcctatgagcggggcgtcaaggta
cgcctgctgatcagctgctggggacactctgacccctcaatgcgggccttcctgctctcc
ctggctgccctgcgtgacaaccacacccactccgacatccaggtgaaactctttgtggtc
cctgcggacgatgcccaggcccgaatcccttatgcccgcgtcaaccataacaagtacatg
gtgactgaacgggccacctacatcggaacctccaactggtctggcagctacttcaccgag
acggcaggcacctcgctgctggtgacacagaacgggcggggtggcctgcggagccagctg
gaggccgtgttcctgagggactgggactccccttatagccatgaccttgacgctgccgcc
gacagcgtgggcaacgcctgtcgcctgctctga

DBGET integrated database retrieval system