KEGG   Bos taurus (cow): 614342Help
Entry
614342            CDS       T01008                                 

Gene name
CDC16
Definition
(RefSeq) cell division cycle protein 16 homolog
  KO
K03353  anaphase-promoting complex subunit 6
Organism
bta  Bos taurus (cow)
Pathway
bta04110  Cell cycle
bta04114  Oocyte meiosis
bta04120  Ubiquitin mediated proteolysis
bta04914  Progesterone-mediated oocyte maturation
bta05166  Human T-cell leukemia virus 1 infection
Module
bta_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    614342 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    614342 (CDC16)
   04114 Oocyte meiosis
    614342 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    614342 (CDC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    614342 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    614342 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bta04121]
    614342 (CDC16)
   03036 Chromosome and associated proteins [BR:bta03036]
    614342 (CDC16)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     614342 (CDC16)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     614342 (CDC16)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    614342 (CDC16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_9 TPR_11 TPR_16 SRP_TPR_like Dynein_light
Motif
Other DBs
NCBI-GeneID: 614342
NCBI-ProteinID: NP_001179919
BGD-bta: BT19236
Ensembl: ENSBTAG00000019971
VGNC: 49933
UniProt: E1BPM5
Position
12
AA seq 620 aa AA seqDB search
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSHEDPRDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHFAAKEHQQALDILDMEEPINKRLFEKCLKDESGLKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLDSLPLSKLCTEEQELLRFLFENKLKKYNKPSETVIPASVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTVEEAGLAPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacctggagcggctgcggaagcgtgtccggcagtacctggaccagcaacagtatcag
agtgctctgttttgggcagataaagtagcttcactctctcatgaggacccccgggacatt
tactggttggcccagtgtctttacctgacagcccagtatcacagggcggctcatgcactt
cggtctcggaaactggacaaattgtacgaagcatgtcgctaccttgcagctagatgccat
tttgctgcgaaagaacatcagcaggctcttgatattcttgacatggaggagccgatcaac
aaacggctgtttgagaaatgtttgaaggatgaaagtggcttgaaagacccctccagtgac
tgggaaatgtcacagtcctcaataaagagttccatttgtcttttacgaggaaaaatctat
gatgctctagacaaccgaaccctcgctacctatagctataaagaagctttgaagcttgac
gtgtattgctttgaagcatttgatctgttaacgtcccaccatatgttgacagcccaagaa
gaaaaagaacttcttgactcactacctcttagcaagctctgcactgaagaacaggaattg
ctacgttttctgtttgagaacaagttgaaaaagtataataagcctagtgaaactgtcatc
cctgcgtctgtagatggtttgcaggagaatctggatgtggtcgtgtctttagctgaaaga
cattattataactgtgattttaaaatgtgctacaagctgacttctgtagtgatggaaaaa
gatcctttccatgcgaattgtttacctgtacatataggaacacttgtagagctgaataaa
gcaaatgaacttttctatctttctcataaattggtggatttatatcctagtaatcctgtg
tcttggtttgcagtgggatgctattatctcatggttggtcataaaaatgaacatgccaga
agatatctcagcaaagctacgacgctggagaagacctacgggccggcatggatcgcgtac
gggcattcgttcgcagtcgagagtgagcatgaccaagcgatggccgcctacttcaccgca
gcgcagctgatgaaagggtgtcacttgccaatgctttatattggattagaatatggattg
accaataactcaaaattggctgaaagattctttggccaagctctaagcatcgcgccagaa
gacccttttgttatgcacgaggttggagtggttgcatttcaaaatggagaatggaaaaca
gcagaaaaatggtttctcgatgctttggaaaaaattaaagcaattgggaatgaggtgaca
gttgacaaatgggaacctttgttgaacaacttgggccatgtgtgcagaaaacttaagaag
tatgctgaggccttggactaccaccggcaggccctggtgttaatccctcagaacgcatcc
acctactccgccatcggctatattcacagtctgatgggcaactttgagaacgctgtggac
tatttccacaccgcccttggtcttaggcgagatgatacattttctgttacaatgcttggt
cattgcattgaaatgtacattggtgattctgaagcttatattggagcagatatcaaagac
aaactaaaatgttatgatttcgatgtgcatacaatgaagacattaaaaaacattatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactgtggaagaagcagggctt
gcaccactagaaacctcaaggaaaaccccagattccagaccttccttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacgtctatgtcagaccacagtaca
tga

DBGET integrated database retrieval system