KEGG   Bos taurus (cow): 614606Help
Entry
614606            CDS       T01008                                 

Gene name
CAMK2N2
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II inhibitor 2
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: CaM-KIIN
Motif
Other DBs
NCBI-GeneID: 614606
NCBI-ProteinID: NP_001107986
BGD-bta: BT22724
Ensembl: ENSBTAG00000005657
VGNC: 26724
UniProt: A5D7T0
Position
1
AA seq 79 aa AA seqDB search
MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIE
DDRIDDVLKGMGEKPPSGV
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagatcctgccctacagcgaggacaagatgggccgcttcggcgccgaccccgag
ggctctgacctctctttcagctgtcgcctgcaggacaccaactccttcttcgcgggcaac
caagccaagcgaccccccaagctgggccagatcggccgagccaagagagtggtgatcgag
gatgaccggatagacgacgtgctgaaggggatgggggagaagccgccgtccggagtgtag

DBGET integrated database retrieval system