KEGG   Bos taurus (cow): 614795Help
Entry
614795            CDS       T01008                                 

Gene name
FKBP1A
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1A
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bta03110]
    614795 (FKBP1A)
Enzymes [BR:bta01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     614795 (FKBP1A)
Chaperones and folding catalysts [BR:bta03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    614795 (FKBP1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 614795
NCBI-ProteinID: NP_001030533
BGD-bta: BT19155
Ensembl: ENSBTAG00000008303
UniProt: P18203
Structure
PDB: 

Position
13
AA seq 108 aa AA seqDB search
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgcaggtggagaccatctctcccggagacgggcgcaccttcccgaagcgtggc
cagacctgcgtggtgcactacacggggatgcttgaagatggaaagaaattcgattcctcc
cgggacagaaacaagccctttaagtttgtgctgggcaagcaggaggtgatccgaggctgg
gaagaaggggttgcccagatgagtgtgggtcagagagccaagctgactatctccccagac
tatgcctatggtgccactggccacccaggcatcatcccaccaaatgccactctcatcttt
gacgtggaacttctaaaactggaatga

DBGET integrated database retrieval system