KEGG   Bos taurus (cow): 614967Help
Entry
614967            CDS       T01008                                 

Gene name
SUMO1
Definition
(RefSeq) small ubiquitin-related modifier 1 precursor
  KO
K12160  small ubiquitin-related modifier
Organism
bta  Bos taurus (cow)
Pathway
bta03013  RNA transport
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    614967 (SUMO1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    614967 (SUMO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bta04121]
    614967 (SUMO1)
   03029 Mitochondrial biogenesis [BR:bta03029]
    614967 (SUMO1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bta04812]
    614967 (SUMO1)
Ubiquitin system [BR:bta04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   614967 (SUMO1)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    614967 (SUMO1)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    614967 (SUMO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 614967
NCBI-ProteinID: NP_001030535
BGD-bta: BT28877
Ensembl: ENSBTAG00000009859
VGNC: 35473
UniProt: Q5E9D1
Position
2
AA seq 101 aa AA seqDB search
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMN
SLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccaggaagcaaaaccttcaaccgaggacttgggggataagaaggaaggagag
tatattaaactcaaagtcattggacaggatagcagtgagattcacttcaaagtgaaaatg
acaacacatctcaagaaactcaaagaatcatactgtcaaagacagggagttcccatgaat
tcactcaggtttctctttgaaggtcagagaattgctgataatcacactccaaaagaactg
ggaatggaggaagaagatgtgattgaagtttatcaggaacaaacagggggtcattcaacg
gtttag

DBGET integrated database retrieval system