KEGG   Bos taurus (cow): 615199
Entry
615199            CDS       T01008                                 

Gene name
UBA52
Definition
(RefSeq) ubiquitin-60S ribosomal protein L40
  KO
K02927  ubiquitin-large subunit ribosomal protein L40e
Organism
bta  Bos taurus (cow)
Pathway
bta03010  Ribosome
bta04120  Ubiquitin mediated proteolysis
bta04137  Mitophagy - animal
bta05012  Parkinson disease
bta05022  Pathways of neurodegeneration - multiple diseases
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    615199 (UBA52)
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    615199 (UBA52)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    615199 (UBA52)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    615199 (UBA52)
   05167 Kaposi sarcoma-associated herpesvirus infection
    615199 (UBA52)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    615199 (UBA52)
   05022 Pathways of neurodegeneration - multiple diseases
    615199 (UBA52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bta03011]
    615199 (UBA52)
   04121 Ubiquitin system [BR:bta04121]
    615199 (UBA52)
Ribosome [BR:bta03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    615199 (UBA52)
  Archaea
    615199 (UBA52)
Ubiquitin system [BR:bta04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitins
   615199 (UBA52)
SSDB
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Other DBs
NCBI-GeneID: 615199
NCBI-ProteinID: NP_001069831
BGD-bta: BT17426
Ensembl: ENSBTAG00000007737
VGNC: 49884
UniProt: P63048
Structure
PDB: 

Position
7
AA seq 128 aa
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgcagatctttgtgaagaccctgacgggcaagaccatcacccttgaggtcgagcccagt
gacaccattgagaatgtcaaagccaaaatccaagacaaggagggcatcccacctgaccag
cagcggctgatcttcgctggcaaacagctggaggatggccgcactctgtcagattataat
atccagaaagagtccaccctgcacttggtgcttcgtctgcgaggcggcatcatcgagcct
tccctccgccagctcgctcagaaatacaactgcgacaagatgatctgccgcaagtgttac
gcccgcctgcacccccgtgctgtcaactgccgcaagaagaagtgtggccacaccaacaac
ctgcgccccaagaagaaggtcaaataa

DBGET integrated database retrieval system