KEGG   Bos taurus (cow): 615215
Entry
615215            CDS       T01008                                 

Gene name
MAPKAPK3
Definition
(RefSeq) MAP kinase-activated protein kinase 3
  KO
K04444  mitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04370  VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    615215 (MAPKAPK3)
   04370 VEGF signaling pathway
    615215 (MAPKAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    615215 (MAPKAPK3)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     615215 (MAPKAPK3)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   615215 (MAPKAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 615215
NCBI-ProteinID: NP_001029951
BGD-bta: BT17895
Ensembl: ENSBTAG00000016532
VGNC: 31229
UniProt: Q3SYZ2
Position
22
AA seq 384 aa
MDVETAEEQGGPAPPSGVPCGPCSAGAPALGGRREPKKYAVTDDYQLSKQVLGLGVNGKV
LECFHRRTGQKCALKLLYDSPKARQEVDHHWQASGGPHIVRILDVYENMHHSKRCLLIIM
ECMEGGELFSRIQERGDQAFTEREAAEIMRDIGTAIQFLHSRNIAHRDVKPENLLYTSKD
KDAVLKLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCG
FPPFYSNTGQAISPGMKRRIRLGQYGFPSPEWSEVSEDAKQLIRLLLKTDPTERLTITQF
MNHPWINQSMVVPQTPLHTARVLQEDRDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSN
NRLLNKRRKKQAGSSSGSQGCNNQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggacgtggagacagcagaggagcaggggggccctgcgcccccgtcaggtgtaccctgc
ggaccttgttccgccggcgctcccgccctcggggggcggcgggagcccaagaagtacgca
gtgaccgatgactaccagttgtccaagcaggtgctgggcttgggtgtgaacggcaaggtg
ctggagtgcttccaccggcgcactgggcagaagtgtgccctgaagctcctgtacgacagc
cccaaggcccggcaggaggtggaccaccactggcaggcctccggtggcccccacatcgtg
cgcatcctggatgtttatgagaatatgcatcacagcaaacgctgtctcctcatcatcatg
gaatgcatggaaggtggtgagttgttcagcaggattcaggagcgtggtgaccaggctttc
actgaaagagaagccgcagagatcatgcgggatattggcactgccatccagtttctgcac
agccggaacatcgcccaccgagatgtcaagcctgaaaacctgctctacacgtccaaggat
aaagatgcggtgctgaagctcacggactttggctttgccaaagagaccacccagaatgcc
ctgcaaactccatgttacactccctactatgtggctcctgaggttctgggtccagagaag
tatgacaagtcatgtgacatgtggtccctgggcgtcatcatgtacatcctcctgtgcggc
ttcccgcccttctactccaacacgggccaggccatctccccggggatgaagaggaggatc
cgcctgggccagtatggcttccccagccctgagtggtccgaggtctccgaggatgccaag
cagctgatccgcctcctgctgaagacggaccccaccgagaggctgaccatcacgcaattc
atgaaccatccctggatcaaccaatcgatggtggtgccccagactccactccacacggcc
cgagtgctgcaggaggacagagaccactgggatgaagtcaaggaggagatgaccagcgcc
ttggcaaccatgcgggtggactatgaccaggtgaagatcaaggacctgaagacctctaac
aaccggctcctcaacaagcggaggaagaagcaggcaggcagctcctccggctcgcagggc
tgcaacaatcagtag

DBGET integrated database retrieval system