KEGG   Bos taurus (cow): 615229
Entry
615229            CDS       T01008                                 

Gene name
SMYD2
Definition
(RefSeq) N-lysine methyltransferase SMYD2
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    615229 (SMYD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    615229 (SMYD2)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     615229 (SMYD2)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     615229 (SMYD2)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     615229 (SMYD2)
SSDB
Motif
Pfam: SET zf-MYND TPR_12 TPR_10 TPR_8
Other DBs
NCBI-GeneID: 615229
NCBI-ProteinID: NP_001069832
BGD-bta: BT29445
Ensembl: ENSBTAG00000013166
VGNC: 35043
UniProt: Q0P585
Position
16
AA seq 433 aa
MRAEGDGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVSERGNHCEFCFARKE
GLSKCGRCKQAFYCNVECQREDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHP
ERTPSEKLLAVKEFESHLDKLDNEKRDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVN
CNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIHPGEEVFTSY
IDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLNDPPKAETIRDMVRYARN
VIEEFRRAKHYKSPSELLEICELSQEKMSCVFEDSNVYMLHMMYQAMGVCLYMQDWEGAL
RYGQKIIQPYSKHYPLYSLNVASMWLKLGRLYMGLENKAAGERALKKAIAIMEVAHGKDH
PYISEIKQEIESH
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagggccgagggtgacggcgggctggagcgcttctgcagcccgggcaagggccggggt
ctgcgggccctgcagcccttccaggtgggggacctgctcttctcctgcccggcttacgcc
tacgtgctcacggtcagcgagcgcggcaaccactgcgagttctgcttcgccaggaaagaa
ggattgtccaaatgtggaagatgcaagcaggcattttactgcaacgtggagtgtcagaga
gaagattggcccatgcacaagctggaatgttctcccatggttgtttttggggaaaactgg
aatccctctgagactgtaaggttgacagcaaggattctggccaaacagaaaatccaccca
gagagaacaccttcagagaaattgttagccgtgaaggagtttgagtcacatctggataaa
ttagacaatgagaagagggatttgattcagagtgacatcgctgctctccatcacttttac
tccaagcaccttgagttccccgacaacgacagcctagtagtgctctttgcccaggttaac
tgtaatggcttcacaatcgaagatgaagaactttctcatttgggatcagcaatatttcct
gatgttgcactgatgaatcatagttgttgccccaatgtcattgtgacctacaaggggacc
ctggccgaagtcagagctgtgcaggaaatccacccgggagaggaggtttttaccagctac
attgacctcctgtacccaacggaagacaggaatgaccggttaagagattcttatttcttc
acctgtgaatgccaggagtgtaccaccaaagacaaggataaggccaaggtggaaatccgg
aagctcaacgaccccccgaaggcagaaaccatccgcgacatggtcagatatgcacgcaat
gtcattgaggagttccggcgagccaagcactacaaatcccctagtgagctgctggagatc
tgcgagctcagccaggagaagatgagctgcgtgttcgaggacagtaacgtgtacatgctt
cacatgatgtaccaggccatgggcgtctgcttgtacatgcaggactgggagggagccctg
cggtacggacagaaaatcatccagccctacagtaagcactatcctctgtactccctcaac
gtggcctccatgtggctgaagctaggaagactgtacatgggcctggagaacaaagctgct
ggggagagagccctgaagaaggccattgccatcatggaagtagctcatggcaaagaccat
ccgtacatttctgagatcaaacaggaaattgaaagccattga

DBGET integrated database retrieval system