KEGG   Bos taurus (cow): 615264Help
Entry
615264            CDS       T01008                                 

Gene name
EYA2
Definition
(RefSeq) eyes absent homolog 2
  KO
K17620  eyes absent homolog 2 [EC:3.1.3.48]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    615264 (EYA2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     615264 (EYA2)
Protein phosphatases and associated proteins [BR:bta01009]
 HAD phosphatases
  EYAs
   615264 (EYA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase
Motif
Other DBs
NCBI-GeneID: 615264
NCBI-ProteinID: NP_001030541
Ensembl: ENSBTAG00000013336
VGNC: 28671
UniProt: Q58DB6
Position
13
AA seq 537 aa AA seqDB search
MLELLVSASLTVNSDRPGKLKPSRADADVWTLSDREGITTSARSVSQLFARPCPRVPPGQ
PPSAMAAYSQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGS
SFSTPASGQSPYTYQMHGTAGIYQGANGLTNAAGFGTVHQDYPSYPGFPQSQYSQYYSSS
YNPPYVPASSICPSPLSTSTYVLQEASHNIPSQSSESLGGEYNTHNGPSTPAKEGDTDRP
PRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTAS
VRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPG
ANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGAPKRETWLQLRAELEALT
DLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKE
SCFERIMQRFGRKAVYIVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgctagaactactggtctcagccagccttactgtaaacagtgatcgtccgggtaaactg
aagcctagccgtgctgatgctgatgtctggactctgagtgacagagaaggcatcaccaca
tcggctcggagtgtgtcccagctctttgcaagaccttgcccgcgtgtcccacctggtcag
cctccctcggccatggcagcctacagccagacacagtacagtgcagggatccagcaagct
accccctacacggcttacccgcctccagcacaagcctatggaatcccttcttacagcatc
aagacagaagacagcttgaaccattcccccggccagagtggcttcctcagctatggctcc
agcttcagcaccccagcctctggacagagcccgtacacctaccagatgcatggcacggcc
gggatctatcaaggagcaaatggactgaccaacgcggccggattcggaactgtgcaccag
gactatccttcctaccccggcttcccgcagagccagtactcccagtattacagctcgtcc
tacaaccctccttacgtcccagccagcagcatctgcccttctcctctctccacgtccacc
tacgtcctccaagaggcatctcacaacatccccagccagagttccgagtcgcttggcggt
gaatataacacacacaatggaccttccacaccggcaaaggagggagacacagacaggcca
ccccgggcctccgacgggaagctccgaggccggtctaagcggagcagcgacccctcccca
gcaggggacaatgagatcgagcgtgtgttcgtgtgggacctggatgagacgataattatt
ttccactccttactcacggggactttcgcctccaggtacgggaaggacaccacggcgtcc
gtgcgcatcggcctcatgatggaggaaatgatcttcaacctcgcagacacacatctgttc
ttcaatgacctggaggattgtgaccagatccacgtggacgatgtctcatctgatgacaat
gggcaagatttaagcacctacaacttctccgccgatggcttccacagttcggccccggga
gccaacctgtgcctgggctccggcgtgcacggcggcgtggactggatgaggaagctggcc
ttccgctaccggcgggtgaaggagatgtacaacacctacaagaacaacgtcggcggcttg
ataggagctcccaaaagagagacctggctacagctcagagccgagctggaagctctgact
gacctctggctgacccactctctgaaggcactaaacctcatcaattcccggcccaattgt
gtcaacgtgctggtcaccaccactcaactaattcctgccctggccaaagtcctgctgtac
ggattgggttctgtgtttcctattgagaacatctacagtgcaaccaagacagggaaggag
agctgcttcgagaggataatgcagaggtttggcagaaaggccgtctacatcgtgatcggc
gatggagtggaagaggagcagggagccaaaaagcacaacatgcctttctggaggatatcc
tgccacgcagacctggaggcgctgaggcacgccctggagctggagtatttatag

DBGET integrated database retrieval system