KEGG   Bos taurus (cow): 615334Help
Entry
615334            CDS       T01008                                 

Gene name
DAO
Definition
(RefSeq) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
bta  Bos taurus (cow)
Pathway
bta00260  Glycine, serine and threonine metabolism
bta00330  Arginine and proline metabolism
bta00472  D-Arginine and D-ornithine metabolism
bta01100  Metabolic pathways
bta04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    615334 (DAO)
   00330 Arginine and proline metabolism
    615334 (DAO)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    615334 (DAO)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    615334 (DAO)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    615334 (DAO)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     615334 (DAO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Pyr_redox UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 615334
NCBI-ProteinID: NP_001193154
BGD-bta: BT14491
Ensembl: ENSBTAG00000018831
VGNC: 27875
Position
17
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYRSVLKSLDVMVYADRFTPLTTTDVAAGLWQPYLSEPS
NPQEAHWNQQTFNYLLSLIGSPNAANMGLAPVSGYNLFREAVPDPYWKDIVLGFRKLTLR
ELDMFPDYSYGWFNTSLILEGRKYLQWLTERLTERGVKFFLWKVESFEEVVREGADVIIN
CTGVWAGALQPDPLLQPGRGQIIKVDAPWLKHFVITHDPERGIYKSPYIIPGLQAITLGG
IFQLGNWSETSNIPDHNTIWEGCCRLEPTLKDAKIIGEWSGFRPVRPQVRLEREQLRFGS
SNTEVIHNYGHGGFGLTIHWGCAQEVAKLFGKILEERNLLRIPPSHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtggtcgtgatcggagcgggcgtcatcgggctgtccaccgccctctgcatccat
gagcgctatcgctcggtcctgaagtcgctggatgtgatggtctatgcagaccgcttcacc
ccactcaccaccaccgacgtggctgccggcctctggcagccctacctctcggagcccagc
aacccacaggaggcgcactggaaccagcagaccttcaactatctcctgagcctcatcggt
tctcccaatgctgcaaacatgggcctggccccggtctcaggctacaacctcttccgtgaa
gctgttccggacccttactggaaggatatagttctgggatttcggaagctgactctcaga
gagctagacatgtttcctgattacagctatggctggttcaacacaagcctgattctggag
gggaggaagtatctgcagtggctgactgaaaggttaactgagagaggagtgaaattcttc
ctgtggaaggtggagtcttttgaggaggtggtaagagaaggcgccgatgtgattatcaac
tgcactggggtgtgggctggggcgctgcaaccagatcccctgctgcagccaggccgaggg
cagatcattaaggtggatgcgccatggttgaaacacttcgttatcacccatgaccctgag
agaggcatctacaagtctccatacatcatcccagggctccaggcaataacccttggcggc
atcttccagctggggaactggagtgagacaagtaatatcccagaccacaacaccatttgg
gaaggctgctgcagactggagcccacactgaaggatgcaaaaattatcggtgaatggtct
ggcttccggccagtacgcccccaggttcgactagaaagagaacagcttcgctttggatcg
tcaaacacagaggtcatccacaactatggccatggaggcttcgggctcaccatccactgg
ggctgtgcccaagaggtggccaagctctttgggaaaattctggaagaaaggaatttgctc
aggataccaccatcccacctctaa

DBGET integrated database retrieval system