KEGG   Bos taurus (cow): 615581Help
Entry
615581            CDS       T01008                                 

Gene name
NXF3
Definition
(RefSeq) nuclear RNA export factor 3 isoform X1
  KO
K14284  nuclear RNA export factor
Organism
bta  Bos taurus (cow)
Pathway
bta03008  Ribosome biogenesis in eukaryotes
bta03013  RNA transport
bta03015  mRNA surveillance pathway
bta05164  Influenza A
bta05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    615581 (NXF3)
   03015 mRNA surveillance pathway
    615581 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    615581 (NXF3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    615581 (NXF3)
   05168 Herpes simplex infection
    615581 (NXF3)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     615581 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     615581 (NXF3)
Ribosome biogenesis [BR:bta03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    615581 (NXF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind
Motif
Other DBs
NCBI-GeneID: 615581
NCBI-ProteinID: XP_024844895
BGD-bta: BT17512
Ensembl: ENSBTAG00000022501
UniProt: Q0II93
Position
Unknown
AA seq 380 aa AA seqDB search
MLLSILEHTDKVNSLQRRARSSGIYRRQYAYWSEPVTSQQQEDKDSKESDAHMDIQGRYA
PYAIPSHHWRSSFQRKDQMHVNMETDQKPPERTMKTNRQDETLGSWFKIIIPFGTKYDEK
WLMNLIQKKCSVPFTAVEFHYEKMQAQFFVENANVACALKNVSGKICNEDNEKISIFVEP
CDAPESVQKTLTSEKLEQIKLTMNKPYDACQQALDIQRLRFGPGMATVVTAGQFPGDLIT
RGIGMTWNRRNSMAASLHVYPGIRPMLSSLYLSNKKPYLVHGLSTIMEIASTTENLNLSN
TEVKIAGEMDKGHQLEPEGVCADRSAVCTTFRDKSTNMRSSSALSLHPYVSLISPLLPPL
PFCLYSPPYLLSPTSITSLP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgtcaattttagagcacactgataaagtgaactctttacaaagaagagcacga
agctcgggtatttaccgaaggcaatacgcctattggtctgaaccggtcacttcccagcag
caggaagacaaagattcaaaagaaagtgatgctcatatggacatccaaggaagatatgct
ccctatgccattccatcccatcactggagaagcagttttcagagaaaagaccaaatgcat
gttaacatggagacagaccaaaagcctccggagagaacaatgaaaacaaatagacaggat
gagaccttggggagctggttcaagattattattccctttggtacaaaatatgatgagaag
tggctgatgaatttgattcagaagaagtgcagtgtcccctttactgcagtcgaatttcac
tatgagaaaatgcaggcccagttctttgtagagaatgccaacgttgcctgtgcattgaag
aatgtcagcggcaagatttgcaatgaggataatgaaaagatatctatctttgttgagccc
tgtgatgcacccgagtctgtgcagaagacactgacatctgaaaagttggagcagataaag
ctcaccatgaacaaaccatacgatgcctgccagcaagctcttgacatccagaggctccgc
tttggccctggtatggctacagtagtgactgcagggcagtttcctggagacttgataaca
cgtggtattggaatgacatggaaccgtagaaatagcatggctgcttccctgcacgtctat
ccagggatcaggcccatgctttcatctttgtacttgagcaacaagaaaccctacttggtg
catggcctgtccaccattatggagattgcttccaccaccgagaacttgaatctctccaac
actgaggtgaagattgcaggggagatggacaagggtcatcagctggaaccagaaggggtg
tgtgcagacagaagcgctgtgtgcaccaccttccgtgataagtcaaccaacatgaggtct
tcctctgccttgtctctacacccctatgtctctctcatctctcccctcctccctccactc
cctttctgtctttattcccctccctacctcctgagtcccacctcaatcacctccctgcca
tag

DBGET integrated database retrieval system