KEGG   Bos taurus (cow): 615785Help
Entry
615785            CDS       T01008                                 

Gene name
SDC2
Definition
(RefSeq) syndecan-2 precursor
  KO
K16336  syndecan 2
Organism
bta  Bos taurus (cow)
Pathway
bta04514  Cell adhesion molecules (CAMs)
bta05144  Malaria
bta05205  Proteoglycans in cancer
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    615785 (SDC2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    615785 (SDC2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    615785 (SDC2)
  09174 Infectious disease: parasitic
   05144 Malaria
    615785 (SDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bta04090]
    615785 (SDC2)
   00535 Proteoglycans [BR:bta00535]
    615785 (SDC2)
CD molecules [BR:bta04090]
 Proteins
  615785 (SDC2)
Proteoglycans [BR:bta00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   615785 (SDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan DUF2721 Glycophorin_A ATG22 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 615785
NCBI-ProteinID: NP_001029960
BGD-bta: BT11139
Ensembl: ENSBTAG00000014357
VGNC: 34379
UniProt: Q58DD4
Position
14
AA seq 202 aa AA seqDB search
MRRAWILLTWVLVACVSAESRAELTSDKDMYLDNNSIEEASGVYPIDDDDYASASGSGAG
EDGESPELTTSRPIPKIPFTSTAPRVETTTLSKIQDKIPAQTKSPEEIDKEKVHLPDSER
KTDPDEEDTNVYTEKHSDNLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSY
DLGERKPSSAAYQKAPTKEFYA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgcttggatcctgctcacctgggtcttggtggcctgcgtgtccgccgagtcg
cgggcagagctgacatctgataaagacatgtaccttgacaacaactccattgaagaagct
tcaggagtgtatcctattgacgatgacgactacgcgtctgcatcaggctcgggagctggt
gaggatggagagagtccagagctgaccacgtctcggcccattccaaagataccattcact
agtactgctccaagagtggaaaccacaacgctgagcaagatacaggacaagatccctgct
cagacaaagtcacctgaagaaattgataaggaaaaagttcacctccctgactcagaaagg
aaaacggacccagatgaagaggacacaaacgtatatactgagaagcactcagacaatctg
tttaaacgaacagaagtcctggcagctgtcattgctggcggagttattggctttctcttt
gcaattttcctcatcctgctgttggtgtatcgcatgagaaagaaggatgaaggaagttat
gaccttggagaacgcaaaccatccagtgctgcttatcagaaggcacctactaaggagttt
tatgcgtga

DBGET integrated database retrieval system