KEGG   Bos taurus (cow): 616118Help
Entry
616118            CDS       T01008                                 

Gene name
CDK15
Definition
(RefSeq) cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    616118 (CDK15)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     616118 (CDK15)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CMGC group
  CDK family
   616118 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7 RIO1
Motif
Other DBs
NCBI-GeneID: 616118
NCBI-ProteinID: XP_024837076
BGD-bta: BT19373
Position
2
AA seq 435 aa AA seqDB search
MGQELCAKALQPGCSCHRCREGGNAHSCQRSAPVMTEAAIELTDLKEASCSMTSFHPRGL
QAVHARKFKSKRPRSNSDSFQEEDLRQGFQWRKSLPFGAASSYLNLEKLGEGSYATVYKG
ISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFVFEY
VHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGELKL
ADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQPLF
PGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPKPQSLQNVFNRLGRAPEA
EDLASQMLKGFPRDRVSAQEALVHNYFSVLPAQLHQLPDEESLFTVSGVRLKPEMCDLLA
SYGKGHHPAGFSKCW
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaagagctgtgtgcaaaggctctgcagcctggatgcagctgccatcgctgtcgg
gagggaggcaacgcacacagctgtcagaggagtgcgcctgtgatgacggaggctgcgatc
gagctaacagacctaaaagaagcatcatgttccatgacttcatttcaccccaggggactt
caggctgtgcatgcccggaagttcaagagtaaaaggccacggagtaacagcgattctttt
caggaagaggatctgaggcaaggttttcagtggaggaagagcctcccttttggggcagct
tcatcttacttgaacttggagaagctgggtgaaggttcttatgctacagtttacaaaggg
attagcaggataaatggacaactagtggctttaaaagtcatcagtatgaatgcagaggaa
ggagtcccatttacagccatccgggaagcttcactcctgaagggtttgaaacatgccaac
attgtgctgctgcatgacataatacacaccaaagagacactgacattcgtatttgaatat
gtgcacacagacctggctcagtatatgtctcagcacccaggagggcttcatcctcataat
gtcaggcttttcatgtttcaacttttgcggggcctggcatacatccaccaccaacacgtt
cttcacagggacctgaaacctcagaacttactcatcagtcacctgggagagctcaaactg
gctgattttggtcttgctcgagccaagtccattcccagccagacatattcttcagaagtt
gtgactctctggtaccgccctcctgatgccttgctgggagccactgagtattcctctgaa
ttggacatatggggtgcaggctgcatctttattgaaatgttccagggtcaacccttgttt
cctggggtttccaacatccttgaacagctggagaagatctgggaggtgctgggagtccct
acagaggatacctggcctggagtttccaagctacctaactacaacccagaatggttcccg
ctgcctaagcctcagagccttcagaatgtcttcaacaggctaggcagggctcccgaagcg
gaagatctggcctcccaaatgctgaagggctttccgagagaccgtgtctcagcccaggaa
gcgctggttcacaattatttcagtgtcctgccggctcagctgcaccagcttccagatgag
gaatcattgtttacagtttcaggagtgaggctgaagccagaaatgtgtgaccttttggcc
tcctacgggaaaggtcaccacccagctgggtttagcaaatgctggtaa

DBGET integrated database retrieval system