KEGG   Bos taurus (cow): 616654Help
Entry
616654            CDS       T01008                                 

Gene name
ASB17
Definition
(RefSeq) ankyrin repeat and SOCS box protein 17
  KO
K10339  ankyrin repeat and SOCS box protein 17
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bta04121]
    616654 (ASB17)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     616654 (ASB17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOCS_box Ank_2 Ank_4
Motif
Other DBs
NCBI-GeneID: 616654
NCBI-ProteinID: NP_001069898
BGD-bta: BT19705
Ensembl: ENSBTAG00000005864
VGNC: 26194
UniProt: Q32KY8
Position
3
AA seq 295 aa AA seqDB search
MSKSSKLCCKTSCPRSNIFCSLVDKVFKRPSLQSLHQWGYHCYEPRVYRTLAKILRYVDL
EGFDILLSDYIAFVEKSGCHLEVNFNLEFTEICVNTILYWVFARKGNPDFVELLLKKTKD
YVQDRSFNLALIWRTFTPVYCPSPLSGITPLLYVAQTRQSNILKILLQYGILERENNPIN
IVLTILLYPSRVRIMVDHELVDIEEDAKTCLVLCSRVLSTISIREIEMQLSLGRRPIISN
WLDYIPSTRYKDPCELLHLCRITIRAQLLTNNMLPNGIFSLLIPVCLQNYLNLES
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatcttctaaattatgttgtaagacttcttgcccacgaagcaatatattctgt
agtctcgttgacaaagtttttaaaagaccatccttgcagtctttgcatcagtggggatat
cactgctatgagcccagggtttatagaacactggcaaaaattctgaggtatgtcgacttg
gaaggatttgacatactactctcagattatattgcatttgtggaaaaatcaggatgccat
ttagaagtaaattttaaccttgaatttactgaaatatgtgtgaatacaattctgtactgg
gttttcgccagaaaaggtaatcctgactttgtggagctgcttctcaagaagacaaaagac
tatgttcaagacagaagttttaacctggcactgatatggagaactttcactccagtatac
tgtccaagcccattaagtggcatcacacctctactttacgtagctcagacgagacaatcc
aatatcttaaaaatactcctgcaatatggaatcttagaaagagaaaataaccctatcaac
attgtgttaacaatattgctctacccttcaagagtgagaataatggttgatcatgaattg
gtagacatcgaggaagatgccaaaacatgtttagtgctctgttccagagtgctttccacc
atttcaatcagggaaatagagatgcagctaagtttaggaagacgtccaattatttcaaat
tggctggactacattccttcaacaagatacaaagatccatgtgaactattacatctctgc
agaataaccatcagggctcaactactaaccaacaatatgctcccaaatggaatattttca
cttctaatccctgtttgtctacagaactatctgaatttagaaagttaa

DBGET integrated database retrieval system