KEGG   Bos taurus (cow): 616818
Entry
616818            CDS       T01008                                 

Gene name
S100A8
Definition
(RefSeq) protein S100-A8
  KO
K21127  protein S100-A8
Organism
bta  Bos taurus (cow)
Pathway
bta04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    616818 (S100A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bta04990]
    616818 (S100A8)
Domain-containing proteins not elsewhere classified [BR:bta04990]
 EF-hand domain-containing proteins
  S100 proteins
   616818 (S100A8)
SSDB
Motif
Pfam: S_100 EF-hand_8 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_4
Other DBs
NCBI-GeneID: 616818
NCBI-ProteinID: NP_001107197
BGD-bta: BT10757
Ensembl: ENSBTAG00000012640
VGNC: 34246
UniProt: P28782 A0A3Q8WS74
Position
3
AA seq 89 aa
MLTDLECAINSLIDVYHKYSLKKGNYHAVYRDDLKQLLETECPKFMKKKDADTWFKELDI
NQDGGINFEEFLVLVIKVGLEAHEEIHKE
NT seq 270 nt   +upstreamnt  +downstreamnt
atgctgacggatctggagtgtgccattaactccctgattgacgtctaccacaagtactcc
ctgaaaaaagggaattaccacgccgtctatagggatgacttgaagcaactgttagagaca
gagtgtcctaaatttatgaagaaaaaggatgcggacacttggttcaaagagttggacatc
aatcaggatggtggaattaacttcgaggagttcctcgtgctggtgataaaggtgggcctg
gaagcccatgaagaaattcacaaagaatag

DBGET integrated database retrieval system