KEGG   Bos taurus (cow): 616916Help
Entry
616916            CDS       T01008                                 

Gene name
REEP1
Definition
(RefSeq) receptor expression-enhancing protein 1
  KO
K17338  receptor expression-enhancing protein 1/2/3/4
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    616916 (REEP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TB2_DP1_HVA22 DUF2306 MHCassoc_trimer DUF2304
Motif
Other DBs
NCBI-GeneID: 616916
NCBI-ProteinID: NP_001075930
BGD-bta: BT23712
Ensembl: ENSBTAG00000004824
VGNC: 33851
UniProt: A2VE59
Position
11
AA seq 201 aa AA seqDB search
MVAWIISRLVVLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLC
WFPFYYELKIAFVAWLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVH
FGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLSTIRGDGAPAPSSPPPPGPGRASG
KHGQPKMSRSASESAGSSGTA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggtggcatggatcatctccaggctggtggtgctaatatttggcactctttaccctgca
tattattcctacaaggctgtgaagtcaaaggacattaaagaatatgtcaaatggatgatg
tactggattatatttgcactattcaccacagcagagacattcaccgacatcttcctttgt
tggtttccattctattatgaactaaaaatagcatttgtagcctggctgctgtctccctac
acaaaaggctccagcctcctctacaggaagtttgtacatcctacactgtcttcaaaagaa
aaggaaattgatgattgcctggtccaagcgaaagaccgaagttacgatgcccttgtgcac
tttgggaagcgaggcttgaacgtggcggccacagcggcagtgatggctgcttccaaggga
caaggtgccttatcggagcgactccggagcttcagcatgcaggatctctccaccatcagg
ggagacggcgcccctgctccctcaagcccccctccaccgggccctgggcgggccagcggc
aagcacggccagcctaagatgtccaggagtgcttctgagagcgctggcagctcaggcacc
gcctag

DBGET integrated database retrieval system