KEGG   Bos taurus (cow): 616938Help
Entry
616938            CDS       T01008                                 

Definition
(RefSeq) olfactory receptor 2T1
  KO
K04257  olfactory receptor
Organism
bta  Bos taurus (cow)
Pathway
bta04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    616938
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    616938
G protein-coupled receptors [BR:bta04030]
 Others
  Chemoreception
   Olfactory
    616938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 616938
NCBI-ProteinID: XP_002689167
BGD-bta: BT21486
Ensembl: ENSBTAG00000024653
Position
7
AA seq 321 aa AA seqDB search
MGSMEEYNTSSTDFTFMGLFNRKETSGLLFAIISIIFFTALMANGVMIFLIRTDSHLHTP
MYFLLSHLSFIDMMYISTIVPKMLVDYLLDQRTITFVGCTAQHFLYLTLVGAEFFLLGLM
AYDRYVAICNPLRYPILMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFF
CEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVIASYAQILTTVHRMSSVEGRKKAF
ATCSSHMTVVTLFYGAAMYTYMLPHSYHRPEQDKVFSVFYTILTPMLNPLIYSLRNKDVT
GAMKRVLDRFKRTQRVSGDAF
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaatggaagagtacaacacatcctctacagactttactttcatggggttgttt
aatagaaaggaaacatcaggcctgctttttgccatcatctctattatcttttttactgca
ttgatggccaatggggtcatgatatttctgatccgcactgattcgcacctccacaccccc
atgtacttcctacttagccacctctccttcattgacatgatgtacatttctaccattgtg
cccaagatgttggtagattacctgctggatcaaaggaccatcacctttgtgggatgcaca
gctcaacacttcctctacctcacccttgtgggagctgagttcttcctgttgggtctcatg
gcctatgaccgctacgtggccatctgtaacccgctccgctatccaatcctaatgagccgc
cgtgtttgctggatgattatagcaggttcctggtttgggggctctttagatggctttctt
ctaactcccataaccatgagtttccccttctgcaactctcgggagattaaccatttcttc
tgtgaggcacctgcagtcctgaaattggcttgtgcagacacagctctctatgagacagtg
atgtatgtgtgttgtgtcttgatgttactgattcctttctctgtggtgattgcctcctat
gctcaaatcctgaccacagtccaccgcatgagctcagtggaagggagaaagaaggcattt
gccacctgttcatctcacatgacagtggtgaccttgttctatggggctgccatgtacact
tacatgctgccacactcttaccaccggccagaacaagacaaagtcttctctgtgttctac
accatcctcacacccatgcttaatccactcatctacagtttgagaaacaaagatgtaact
ggagctatgaagagggtactggacaggttcaagcgtacacagagagtgtcaggggatgct
ttttga

DBGET integrated database retrieval system