KEGG   Bos taurus (cow): 617340
Entry
617340            CDS       T01008                                 

Gene name
COL26A1
Definition
(RefSeq) collagen alpha-1(XXVI) chain precursor
  KO
K24358  collagen type XXVI alpha (EMI domain-containing protein 2)
Organism
bta  Bos taurus (cow)
Pathway
bta04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    617340 (COL26A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bta04990]
    617340 (COL26A1)
Domain-containing proteins not elsewhere classified [BR:bta04990]
 C1q domain-containing proteins
  Emilin / mutimerin group proteins
   617340 (COL26A1)
SSDB
Motif
Pfam: Collagen EMI
Other DBs
NCBI-GeneID: 617340
NCBI-ProteinID: NP_001180083
BGD-bta: BT25940
Ensembl: ENSBTAG00000011818
VGNC: 52757
UniProt: E1BKJ9
Position
25
AA seq 438 aa
MKLALLLPWACCCLCGSALATGFLYPFPAAALQQHAYPDPGAGSPGSGYGGRRHWCHHTV
TRTVSCQVQNGSETVVQRVYQSCRWPGPCANLVRTLIRPTYRVSYRTVTALEWRCCPGFT
GSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPPGPDNDLPTPQNTPPPWNEGLLP
DAIPLAHPGPQMRRPTGPAGPPGQTGPPGPAGPPGSKGDRGQAGEKGPAGPPGLLGPPGP
RGLPGEMGRPGPPGPPGPAGSPGLPPNGPQGVLYSLQPPTDKDSGDVQLASAAVDTVLAG
VPGPRGPPGPPGPPGPHGPPGPPGVPGSQGLAGERGATGPSGEPGGKGEEEEKAAAEGEG
VQQLREALKILAERVLILEHMIGIHDPQATPEGGSGQDAALRANLKMKRGGPPPDGSLAA
LLGPDPGQRSAGRTSGGK
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgaagctggctctgctcctgccctgggcgtgctgctgcctctgcgggtcggcgttggcc
accggcttcctctaccccttcccggccgcggccctgcagcagcacgcctatcctgacccg
ggcgccggctcccccggcagcggctacgggggccgccggcactggtgccatcacacggtg
acacggacggtgtcctgccaggtgcagaacggctcggagacggtggtccagcgcgtgtac
cagagctgccggtggcctgggccctgcgccaacctcgtgaggactctgatcagacccaca
tacagagtgtcctaccgaacggtgacggcgctggaatggaggtgctgccctggctttact
gggagcaactgtgatgaggaatgcatgaactgcacccggctcagcgacatgagcgagcgg
ctgaccacgctggaggccaaggttctccttctggaagcagcagagcggcccccaggccca
gacaatgaccttccgacgccccagaacaccccaccaccctggaacgagggtctcctccct
gacgccatcccgcttgcccaccccgggccccagatgagaaggcccacaggcccggccggg
ccccctggacagacgggaccaccagggcctgcgggtcccccaggctccaaaggtgaccgg
ggtcaggcaggagaaaagggcccagcggggcctcctggcctcttggggccgccagggccc
cgtgggcttcctggagagatggggcgccctggcccccctggcccccctggcccagcaggc
agcccgggcctccctccaaacggcccccaaggcgtcctctactccctgcagccaccgacg
gacaaggacagtggagacgtgcagctggcctccgcagccgtggacacagtgttggcgggc
gtcccagggccccggggtccccctggccccccagggccccctggaccacacggcccccct
ggacccccgggtgtgcctggatcccagggcctggctggagagcggggcgccacggggccg
tctggggagcctggcgggaagggggaagaggaggagaaagccgccgctgagggcgagggg
gtgcagcagctgcgggaggccctgaagattttggccgagagagtgctcatcctggagcac
atgattgggatccacgatccccaggccacccctgaggggggctctggccaggacgccgcc
ctgagagccaacctcaagatgaagcgcggaggccccccacccgatggctccctggccgcc
ctgctcgggcccgaccccgggcagaggagtgctggccggaccagcggcgggaagtaa

DBGET integrated database retrieval system