KEGG   Bos taurus (cow): 617419Help
Entry
617419            CDS       T01008                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bta  Bos taurus (cow)
Pathway
bta01040  Biosynthesis of unsaturated fatty acids
bta01212  Fatty acid metabolism
bta03320  PPAR signaling pathway
bta04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    617419 (SCD5)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    617419 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    617419 (SCD5)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     617419 (SCD5)
Lipid biosynthesis proteins [BR:bta01004]
 Desaturase
  First
   617419 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 617419
NCBI-ProteinID: NP_001070413
BGD-bta: BT11419
Ensembl: ENSBTAG00000022449
VGNC: 34328
UniProt: Q2KIA4
Position
6
AA seq 335 aa AA seqDB search
MPGPAVDAEKVPFRSAKEEIRAGVGVEGSEGGGGGGGRERPGARGHRQDIVWRNVFLMSL
LHLAAVYSLVLIPKAQPLTLLWAYFCFLLTALGVTAGAHRLWSHRSYKAKLPLRIFLAAA
NSMAFQNDIFEWSRDHRVHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLD
VTDLLADPVVRFQRKYYKITVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNVT
WLVNSVAHMYGNRPYDKHISPRQNPLVTLGAIGEGFHNYHHTFPFDYSASEFGLNFNPTT
WFIDFMCWLGLATDRKRATKQMIEARKARTGDGSA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccaggcccggccgtggacgcggagaaggtccccttccgcagcgccaaggaggagatc
cgtgcgggggtaggggtcgagggctcggagggcggcggcggcggcggcggccgggagagg
cccggcgcgcgcgggcaccggcaggacatcgtctggaggaacgtgttcctgatgagcctg
ctccacttggcggccgtgtactccctggtgctcatccccaaagcccagccgctcactctg
ctctgggcctacttctgcttcctcctgactgctctgggtgtgacagctggtgcccatcgt
ttgtggagccacaggtcctacaaggctaagctacccctgaggatatttctggctgctgcc
aactccatggctttccagaatgacatcttcgagtggtcgagggaccaccgagtccatcac
aagtactcggagacggacgctgacccacacaatgcccgccggggcttcttcttctcccac
atcggctggctgtttgtccgcaagcatcgggacgtcattgagaaggggaggaagcttgac
gttaccgacttgctggctgaccctgtggtccggttccagagaaagtactacaagatcacc
gtggtgctcatgtgcttcgtagtccccacgctggtgccctggtacatctggggagaaagc
ctgtggaactcctacttcctggcctccatcctccgctacaccatctcactcaacgtcacc
tggctggtgaacagtgtcgctcacatgtacggaaaccggccctatgacaagcacatcagc
cctcggcagaacccgctcgtcaccctgggtgccattggtgaaggtttccataactaccat
cacacctttccctttgactactctgcgagtgaatttggcttaaatttcaacccaaccacc
tggttcattgacttcatgtgttggctggggctagccactgaccgcaaacgggcaaccaag
cagatgatcgaagcccggaaagcccggactggagacgggagcgcctga

DBGET integrated database retrieval system