KEGG   Bos taurus (cow): 617720Help
Entry
617720            CDS       T01008                                 

Gene name
NUDT12
Definition
(RefSeq) peroxisomal NADH pyrophosphatase NUDT12
  KO
K03426  NAD+ diphosphatase [EC:3.6.1.22]
Organism
bta  Bos taurus (cow)
Pathway
bta00760  Nicotinate and nicotinamide metabolism
bta01100  Metabolic pathways
bta04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    617720 (NUDT12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    617720 (NUDT12)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.22  NAD+ diphosphatase
     617720 (NUDT12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX zf-NADH-PPase NUDIX-like DNA_ligase_ZBD
Motif
Other DBs
NCBI-GeneID: 617720
NCBI-ProteinID: NP_001040073
Ensembl: ENSBTAG00000027728
VGNC: 32326
UniProt: Q29RH3
Position
7
AA seq 444 aa AA seqDB search
MSSVKRSLNQEIISQFHYSAAEGDIAKLTAILSHSPSLLNETSENGWSALICDRSIVNKS
RQTALDIAKFWGYKHIANLLANAKGGKKPWFLTNEVEECENYFSKTLLDRKSEKRNNSDW
LLAKESHPATVYILFSDLNPLVTLGGNKESFQQPEVRLCQLNYTDIKDYLAQPEKITLIF
LGVELEMKKEFFNYAGEISKEEEDGLVAWFALGIDTVAAEEFKQRHENCYFLHPPMPALL
QLKEKEAGVVAQARSVLAWHSRYKFCPTCGNATKIEEGGYKRVCLKEDCPSLHGVHNTSY
PRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPGETIEDAVRREVEEESGVK
VGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDARWFTREQVVDVLTKGKQQA
FFVPPSRAIAHQLIKHWIGMNPNL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgtaaaaagaagtctgaatcaagaaataatatcccagtttcactattcagct
gcagaaggagatattgccaagttaacagcaatactcagtcattctccatctcttctcaat
gaaacttctgaaaatggctggagtgctttaatatgcgacagatccattgtcaacaaatca
aggcagactgcactggatatagctaaattttggggttataagcatatagctaacttatta
gctaatgctaaaggtgggaagaagccttggttcctaaccaatgaagtggaagaatgtgaa
aattattttagcaagacactactggaccggaaaagtgaaaaaagaaataattctgactgg
ctgttagcaaaagaaagccatccagccacagtttatatccttttctcagatttaaatccc
ttggttactctaggaggcaataaagaaagttttcaacagccagaagtcaggctttgtcag
ctgaactacacagatataaaggattatttggctcagcctgaaaagatcaccttgattttc
cttggagtagaacttgaaatgaaaaaagagttttttaattatgctggggaaatctcaaaa
gaagaagaagatgggttggttgcctggtttgctttaggtatagatactgttgctgctgaa
gaatttaagcaaaggcatgaaaattgttattttcttcatccaccaatgccagctcttctg
caattgaaagaaaaagaagctggggttgtagctcaagcaagatctgttctcgcttggcac
agtcggtataagttctgcccaacctgtggaaatgcaactaaaattgaagaaggtggctat
aaaagagtatgcttaaaagaagactgtcctagtctccatggtgttcacaatacatcatac
ccaagagttgatccagtggtaatcatgcaagttattcatcccgatgggaccaaatgtctt
ttaggcaggcagaagagatttcctccgggcatgtttacttgcctcgctggatttattgaa
cctggggagacaatagaagacgctgttcggagagaagtagaagaggaaagtggagtcaaa
gttggccatgttcagtatgtctcttgtcaaccgtggccaatgccctcttccttaatgatt
ggttgcttagctgtggcagtgtctacagaaattaaagttgacaagaatgaaatagaggat
gcccgctggttcactagagaacaggttgtggatgttctgaccaaaggcaagcagcaggca
ttctttgttccaccgagccgagctattgcacatcagttaatcaaacactggattggaatg
aaccccaatctctaa

DBGET integrated database retrieval system