KEGG   Bos taurus (cow): 617960Help
Entry
617960            CDS       T01008                                 

Gene name
F7
Definition
(RefSeq) coagulation factor VII precursor
  KO
K01320  coagulation factor VII [EC:3.4.21.21]
Organism
bta  Bos taurus (cow)
Pathway
bta04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    617960 (F7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    617960 (F7)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.21  coagulation factor VIIa
     617960 (F7)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   617960 (F7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Gla FXa_inhibition DUF1986 EGF cEGF hEGF Trypsin_2 EGF_2
Motif
Other DBs
NCBI-GeneID: 617960
NCBI-ProteinID: NP_001029978
BGD-bta: BT11851
Ensembl: ENSBTAG00000007411
VGNC: 28689
UniProt: P22457
Position
12
AA seq 447 aa AA seqDB search
MLSQAWALALLCFLLSLWGSLPAVFLPQEQALSILHRPRRANGFLEELLPGSLERECREE
LCSFEEAHEIFRNEERTRQFWVSYNDGDQCASSPCQNGGSCEDQLRSYICFCPDGFEGRN
CETDKQSQLICANDNGGCEQYCGADPGAGRFCWCHEGYALQADGVSCAPTVEYPCGKIPV
LEKRNGSKPQGRIVGGHVCPKGECPWQAMLKLNGALLCGGTLVGPAWVVSAAHCFERLRS
RGNLTAVLGEHDLSRVEGPEQERRVAQIIVPKQYVPGQTDHDVALLQLAQPVALGDHVAP
LCLPDPDFADQTLAFVRFSAVSGWGQLLERGVTARKLMVVLVPRLLTQDCLQQSRQRPGG
PVVTDNMFCAGYSDGSKDACKGDSGGPHATRFRGTWFLTGVVSWGEGCAAAGHFGIYTRV
SRYTAWLRQLMGHPPSRQGFFQVPLLP
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccaggcctgggctctggccctcctctgctttctgctcagcctgtgggggtcc
ctgccggcagtcttcctgccccaggagcaggccctcagcatcctgcatcggcctcggcgt
gccaacgggttcctggaggagctgctgccgggctcgctggagcgggagtgcagggaggag
ctctgctccttcgaggaagcccacgagatcttccgcaacgaggagaggacgaggcagttc
tgggtttcctacaatgacggggaccagtgcgcctccagcccctgccagaacgggggctcc
tgtgaggaccagctccggtcctacatctgcttctgccccgacggcttcgagggccggaac
tgtgagaccgacaagcagagccagctgatctgcgccaacgacaatggcggctgtgagcag
tactgtggggctgacccgggggccgggcgcttctgctggtgccatgagggctacgcgctc
caggcagacggggtgtcctgcgcacccacagtggaatatccgtgcgggaaaatacctgtt
ctggaaaaaagaaatggcagcaagccccaagggcgaattgtggggggccacgtctgcccc
aaaggggaatgcccctggcaggccatgctgaagctgaacggggcgctgctgtgcgggggc
accctggtcggcccggcctgggtggtctccgccgcccactgcttcgaaaggctccggagc
agggggaacctgacggctgtgctgggcgagcacgacctcagccgcgtggagggcccagag
caggagcggcgggtggcgcagatcattgtccccaagcagtacgtgccgggccagacggac
cacgacgtggccctgctgcagctggcccagcccgtggccctgggcgaccacgtggcaccc
ctctgtctgcccgacccggacttcgcggaccagacgctggccttcgtgcgcttctcggcc
gtcagcggctggggccagctcctggagcgcggggtcaccgcccgcaagctcatggtggtg
ctggtgccccggctgctaacccaggactgcctgcagcagtcgcgccagaggcccggcggg
cctgtggtcacggacaacatgttctgcgctggctatagcgacggcagcaaggatgcctgc
aagggggacagtgggggcccgcacgccacacgcttccggggcacctggttcctgaccggc
gtcgtcagctggggcgagggctgcgcggcagccggccactttgggatctacacgcgggtc
tcccgctacacggcctggctgcggcagctgatgggccacccgccgtccaggcagggcttc
ttccaggtcccgctgctgccctag

DBGET integrated database retrieval system