KEGG   Bos taurus (cow): 618024Help
Entry
618024            CDS       T01008                                 

Gene name
GEMIN7
Definition
(RefSeq) gem-associated protein 7
  KO
K13135  gem associated protein 7
Organism
bta  Bos taurus (cow)
Pathway
bta03013  RNA transport
Module
bta_M00426  Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    618024 (GEMIN7)
Spliceosome [BR:bta03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    618024 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gemin7 SUZ-C
Motif
Other DBs
NCBI-GeneID: 618024
NCBI-ProteinID: NP_001069957
BGD-bta: BT14072
Ensembl: ENSBTAG00000010668
VGNC: 29320
UniProt: Q17QA0
Position
18
AA seq 125 aa AA seqDB search
MQTPLATPVPVLRLPRGPDGSNRGFAPDGRRAPPKPEVPEPPESRESWEQQARASLRERY
LRSLLAMVGRPVCFTLHEGVQVIAHFGATDLDVANFYVSQLQTPIGIQAEALLRCSDIIS
YTFKP
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcagactccgctggccactcctgtgcctgtgctccggctcccccggggtcctgatggc
tccaaccgaggctttgctcccgatggacgcagagccccgccgaaaccggaagtcccggag
cctccagagtctcgggaatcctgggaacagcaggctcgagcctccctccgggagcgctac
ctccgcagcctgctggccatggtggggcgcccagtgtgcttcactttgcacgagggtgtg
caggtgatcgcccacttcggagccaccgacctggacgtggccaatttctatgtgtcgcag
cttcagactccaataggcattcaggctgaagcactcctccggtgtagtgacattatctca
tacaccttcaagccataa

DBGET integrated database retrieval system