KEGG   Bos taurus (cow): 618180Help
Entry
618180            CDS       T01008                                 

Gene name
FFAR1
Definition
(RefSeq) free fatty acid receptor 1
  KO
K04325  free fatty acid receptor 1
Organism
bta  Bos taurus (cow)
Pathway
bta04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    618180 (FFAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    618180 (FFAR1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Lipid
   Free fatty acid
    618180 (FFAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 618180
NCBI-ProteinID: NP_001296575
BGD-bta: BT26427
Ensembl: ENSBTAG00000045806
VGNC: 28961
UniProt: G3MZT6
Position
18
AA seq 300 aa AA seqDB search
MDLPPQLSFALYVAAFVLGFPLNTLAIAGAVSHARLRLTPSLVYALHLGCSDLLLATSLP
LKAVEALAGGTWPLPAPLCPAFALVHFAPLYAGGGFLAALSVGRYLGAAFPLGYQAARRP
LYSWGVCVAVWAIVLCHLGLVFGLEAPGGWLDNSTSSLGISTPINGSPVCLEAWDPASAG
PARFSLSLLLFFLPLVITAFCYVGCLRALAHSGLSHRRKLKAAWVAGGALLTLLLCLGPY
NASNVAGFLHPDIGGQWRQLGLITGAWSVVLNPLVTGYLGGHPGQGTVCVAKTKAGASQK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccccgcagctctccttcgccctctatgtggctgccttcgtgctgggcttt
ccactcaacaccttggccatcgcgggcgccgtgtcccacgcccggctgcgcctcaccccc
agcttggtctatgccctccacctgggctgctctgatctcctgctggcgacttctctgccc
ctgaaggcagtggaggccctggctgggggcacctggcccctgccggcccctctctgtcct
gccttcgccctggtccacttcgctccactctatgcgggagggggcttcctggccgccctg
agtgttggccgctacctcggagctgccttccccttgggctaccaagctgcccggaggccg
ctctactcctggggcgtgtgtgtggccgtatgggccatcgttctctgtcacctggggctg
gtctttgggctggaggccccggggggctggctggacaattccaccagctccttgggcatc
agcacaccaatcaatggctctccggtctgcctggaggcctgggacccagcatcggcaggc
ccggctcgctttagcctctcgcttctgctcttctttctgcccctggtcatcacagccttc
tgctacgtgggctgcctccgggcactggcccactcgggcctgagccacagacggaagcta
aaggcggcctgggtggctggcggggccctgctcacattgctgctctgcttaggaccctac
aacgcctccaacgtggctggcttcctgcaccccgacattggaggccagtggcggcagctg
gggctcatcacaggtgcttggagcgtggtgctcaaccctttggtgactggctacttggga
ggccaccctggccaggggacagtctgtgtggcaaaaacaaaagcaggggcatcccagaaa
tag

DBGET integrated database retrieval system