KEGG   Bos taurus (cow): 618267Help
Entry
618267            CDS       T01008                                 

Gene name
AP4S1
Definition
(RefSeq) AP-4 complex subunit sigma-1
  KO
K12403  AP-4 complex subunit sigma-1
Organism
bta  Bos taurus (cow)
Pathway
bta04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    618267 (AP4S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    618267 (AP4S1)
Membrane trafficking [BR:bta04131]
 Endosome - Golgi transport
  Others
   AP-4 complex
    618267 (AP4S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clat_adaptor_s PHD_like
Motif
Other DBs
NCBI-GeneID: 618267
NCBI-ProteinID: NP_001035693
BGD-bta: BT18921
Ensembl: ENSBTAG00000017201
VGNC: 25994
UniProt: Q3ZBB6
Position
21
AA seq 144 aa AA seqDB search
MIKFFLMVNKQGQTRLSKYYEHVEINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYR
QYAALFIVVGVNDTENEMAIYEFIHNFVEVLDDYFSRVSELDIMFNLDKVHIILDEMVLN
GCIVETNRARILAPLLILDKMSDS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgataaagtttttcctcatggtgaataaacaagggcagacccgactttctaagtactat
gaacatgtggagattaataagcgtacgcttctggaaacagaagtcatcaagagctgtctc
tctcgatccaatgaacaatgttctttcattgaatataaagactttaagctgatataccgg
cagtatgcagctctcttcattgtggttggagttaatgacacagagaacgagatggcaatt
tatgaattcatccataactttgtggaagttttagatgactacttcagccgagtgagtgaa
ctagatatcatgtttaacttggataaagtacacatcattttggatgagatggtattaaat
ggctgcattgtggaaacgaacagggcaagaattcttgcccctctactaattcttgataaa
atgtcagacagctga

DBGET integrated database retrieval system