KEGG   Bos taurus (cow): 618278Help
Entry
618278            CDS       T01008                                 

Gene name
COMT
Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
bta00350  Tyrosine metabolism
bta01100  Metabolic pathways
bta04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    618278 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    618278 (COMT)
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    618278 (COMT)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     618278 (COMT)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   618278 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI PCMT Methyltransf_15 CCB2_CCB4
Motif
Other DBs
NCBI-GeneID: 618278
NCBI-ProteinID: NP_001095787
BGD-bta: BT27885
UniProt: A7MBI7
Position
17
AA seq 272 aa AA seqDB search
MLEAPPLLLVAGGVGLALLALRWLATTDLQFFGRAFIVWNEFIMKPIRNLLMGSSKEQRI
LQHVLQHAVAGDPQSVVAAIDSYSLEKEWAMHVGEKKGQIVDRVLREQQPSVLLELGAYC
GYSAVRMARLLLPGARLLTIEFNPDYAAITQRMVEFAGLQDKVTVVLGASQDIIPQLKKK
YDVDTLDMVFLDHWKDRYLPDMLLLEECGLLREGTVLLADNVIYPGAPDFLEYVRGNSRF
ECSHFSSYLEYSKVVDGLEKVVYKGLSGPARP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgctggaggccccgcccctgctgctggtcgctggtggcgtaggcctggccctgctcgcg
ctgcggtggctggccacaacggacctgcagttcttcggccgggcctttatcgtctggaac
gagttcatcatgaagcccatccgcaacctcctcatgggcagcagcaaggagcagcgcatc
ctgcagcacgtgctgcagcacgcggtggccggggacccgcagagcgtggtggccgccatc
gacagctacagcttggagaaggagtgggccatgcacgtgggcgagaagaaaggccagatc
gtggacagggtgctgagggaacagcagccgtccgtactgctggagctgggcgcctactgc
ggctactcggcagtgcgaatggcccgcctgctgctgcccggcgcccggctgctcaccatc
gagttcaatcccgactatgccgccatcacccagcggatggtggagtttgcaggcctgcag
gacaaggtcaccgttgttcttggagcatcccaggacatcatcccccagctgaagaagaaa
tacgatgtggacaccctggacatggtctttctcgaccactggaaggaccgctacctgccg
gacatgcttctcctggaggagtgcggcctgctgcgggaggggacagtgttgctggctgac
aacgtcatctaccctggggcgcccgactttctggagtacgtgcgcgggaacagccgcttc
gaatgttcgcacttcagctcgtacctggagtactccaaggtggtggacggcttggagaag
gtcgtctacaagggcctgagcggccctgctcggccctga

DBGET integrated database retrieval system