KEGG   Bos taurus (cow): 618574Help
Entry
618574            CDS       T01008                                 

Gene name
BPIFB2
Definition
(RefSeq) BPI fold-containing family B member 2 precursor
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP
Motif
Other DBs
NCBI-GeneID: 618574
NCBI-ProteinID: NP_001180123
Ensembl: ENSBTAG00000019200
VGNC: 26546
UniProt: F1MI67
Position
13
AA seq 459 aa AA seqDB search
MPGACGLGLLLALMLLPVVSASRPGTVFRLNKEVLSYAAEAGKAPLQNALQVTVPLFLDE
SGGVFQPTRIQIRNVDVSHLQLTFVADFGIRLLAATNFTFKIFRDPEPLHLLLPIALLAD
TSVEQGSIGTPVVSISSCFSIFDKAIVFDGRNSTAPAMLAPLQSHITAVLKSKLCLRISN
LVQGLNVHLGTLIGLSPVGPESQVRYSMIDTPTITNDYISLDINAVLFLLGRPIVLPVDT
TPFVLPQHMGTKGAMATVGLSQDLFDSVIMLLQKAGALNLDVTAQLNSSNNPLNTSVLGQ
FIPEVARQFPEPMPLLLKVRLGATPTVTFRTNNATLQLQPFVEVLAPTSNSAFQYLFSLN
VVMNLSLQLSVSKVRLRGTTSVLGNVQLTVASSNLGFIDTNHVQTLMGEVFEKPLLDHLN
ALLGMGIALPHVVNLQYVNPEIFIQEGYVVVSSGLLYQR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggcgtgtgggctgggcctgctgctggcactgatgctgctgcccgtggtcagt
gcctccaggccgggcaccgtgttcagactcaacaaggaagtgctgagctatgcggctgaa
gccgggaaagccccgctccagaatgccctgcaggtcacagtgccgcttttcctggacgag
agtggaggggtcttccagcccaccaggattcagattcggaatgtcgatgtgtcccacctc
cagctgacatttgttgccgatttcggaatacgcttgttggcagccaccaattttactttc
aagatcttccgtgacccggagcccctgcacctgctgctccccatagcactgctggctgac
acctccgtggagcagggctccatcgggacccccgtggtcagcatctccagctgcttttcc
atcttcgacaaagccatcgtgtttgatggccgcaacagcacagcccccgcgatgctggcc
ccgctgcagagtcacatcacagctgtgctgaagagcaagctgtgcctgagaatctccaac
ctggtgcaaggcctcaatgtccacctgggcactttaattggcctcagccctgtgggtcca
gaatcccaggtccgctactccatgattgacacccctaccatcaccaacgactacatttcc
ttggatatcaacgctgttctcttcctgctgggcagacccatcgtcctgcctgtggatact
acccccttcgtgctgccacagcacatgggcaccaagggtgccatggcaaccgtgggcctc
tcccaggacctgtttgactctgtcatcatgctgctgcagaaggctggtgcgctcaacctg
gacgtcacagcacagctgaattcgagtaacaacccgctgaacacctctgtgctgggccag
ttcatccccgaggtggcccgtcaattccccgagcccatgcccctgctgctcaaggtgagg
ctgggtgccacgcccacagtcacgttccgcaccaacaacgccacgctgcagctgcagccc
tttgtggaagtcctggccccgacctccaactcggctttccagtacctcttctccctcaat
gtggtgatgaacctgagcctccagctttctgtgtccaaggtgaggcttcgggggaccaca
tctgtgctggggaatgtccagctcaccgttgcctcctccaatctgggcttcattgatacc
aaccatgtccagacactcatgggcgaagtgtttgagaagcccttgctggaccacctcaat
gctctcttgggcatggggattgccctcccccacgtggtcaatctccagtacgtcaaccct
gagatttttatccaggagggctatgtcgtggtgtccagtggactcttgtaccagcgctga

DBGET integrated database retrieval system