KEGG   Bos taurus (cow): 618600
Entry
618600            CDS       T01008                                 

Gene name
MGC134232
Definition
(RefSeq) uncharacterized protein LOC618600
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: ARF7EP_C
Other DBs
NCBI-GeneID: 618600
NCBI-ProteinID: NP_001103653
BGD-bta: BT30344
Ensembl: ENSBTAG00000038660
UniProt: A8PAU8
Position
X
AA seq 151 aa
MSEQAEKSSSVRERPARQSSPEKPSEKELKQKKRLDRQLKRLSFQNPGPQVANFNPEIRQ
QIKKGQMAKKNEFVSVKREGNKYDKKGRLTFNEADLCDCLDEDCLGCFYPCPKCKSTKCG
PICRCNRRWAYDTIVNENGEVISKMPFDLSE
NT seq 456 nt   +upstreamnt  +downstreamnt
atgagtgaacaagcagaaaagagcagttccgtgcgagagagacctgcacgtcaaagttct
cctgagaaaccaagtgagaaggaactgaagcaaaagaaacggttggatcggcagttaaaa
cggttgtcatttcaaaatcccgggcctcaggtagccaactttaatcctgaaataaggcag
cagataaagaaagggcaaatggcaaagaagaatgagtttgtttctgtaaaacgcgaaggc
aacaagtatgacaaaaagggcaggctcaccttcaatgaggctgacctgtgtgactgcctt
gatgaagactgcctgggttgcttctacccgtgccccaagtgtaagtccaccaagtgcggg
cccatttgccgctgcaaccgccgctgggcctatgacactatagtcaatgagaatggggag
gtcatcagcaagatgccattcgacctctccgaatag

DBGET integrated database retrieval system