KEGG   Bos taurus (cow): 618605Help
Entry
618605            CDS       T01008                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1 isoform X2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
bta  Bos taurus (cow)
Pathway
bta00600  Sphingolipid metabolism
bta01100  Metabolic pathways
bta04020  Calcium signaling pathway
bta04071  Sphingolipid signaling pathway
bta04072  Phospholipase D signaling pathway
bta04370  VEGF signaling pathway
bta04371  Apelin signaling pathway
bta04666  Fc gamma R-mediated phagocytosis
bta05152  Tuberculosis
Module
bta_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    618605 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    618605 (SPHK1)
   04371 Apelin signaling pathway
    618605 (SPHK1)
   04020 Calcium signaling pathway
    618605 (SPHK1)
   04072 Phospholipase D signaling pathway
    618605 (SPHK1)
   04071 Sphingolipid signaling pathway
    618605 (SPHK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    618605 (SPHK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    618605 (SPHK1)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     618605 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Tim54
Motif
Other DBs
NCBI-GeneID: 618605
NCBI-ProteinID: XP_002696250
BGD-bta: BT25652
Ensembl: ENSBTAG00000008507
VGNC: 35210
Position
19
AA seq 475 aa AA seqDB search
MLGSPVRMGSPRPVYTAKLLSDPATAGNDAGAPTAPATGGEGEPHSRHREARLGSTDKEL
KSGAAAADSVRTAPGTPRQRGEVMDAAGGSRNTLPRPCHVLVLLNPRGGKGKALQLFRSH
VQPLLAQADVSFTLMLTERRNHARELVRAEDLRRWDALVVMSGDGLIHEVVNGLMERPDW
ETAIQKPLCSLPAGSGNAVAASLNYYAGYEQVTKEDLLTNCTQLLCRRLLAPMDLLSLQT
ACGQRLFSVLSLAWGFIADVDLESEKFRRLGEMRFTLGACLRLVALRTYRGSLAYLPAET
LASRRGPSPALAPQDPADTHVVPLEQPVPPHWTVVPEQDFVLVLALLHSHLASDLFTAPM
GRCSAGAMHLFYVRAGVSRAMLLRLFLAMEKGRHMECHCPHLVYVPVVAFRLEPKDGKGV
FTVDGELLISEAVQGQVLPNYFWMVSGYREPPPSLKPQPSPRRKSQQTLPPSERP
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcttggctccccagtccggatggggtcgcctaggcctgtttacaccgccaagctcctt
tcagatccggcaaccgcagggaatgacgcgggtgcccccacagccccggcaacgggcggg
gagggcgagccccatagccgtcaccgagaggcccgcctgggcagcaccgataaggagctg
aagtcaggagccgccgcggcggacagcgtccggacggcgccggggacccctcggcagcgg
ggcgaggtcatggatgcagcgggcggctcccggaacacgctcccaaggccctgccacgtg
ctggtgttgttaaatccgcgcgggggcaagggcaaagccctgcagctcttcaggagccac
gtacagccgctgctggcccaggccgacgtctccttcacgctgatgctcactgagcggcgg
aaccacgcccgggagctggtgcgtgcggaggacctgagacgctgggacgcgctggtggtc
atgtccggagatgggctgatccacgaggtggtgaacgggctcatggagcggcctgactgg
gagaccgccatccagaagcccctgtgtagcctcccggcaggctctggcaatgcagtggcc
gcttctttgaactattacgccgggtacgagcaggtgactaaggaagacctcctgaccaac
tgcacgcagctgctgtgccgccggctgctggcgcccatggacctgctatccctgcagacc
gcctgcgggcagcgcctcttctctgtgctcagcctggcgtggggtttcatcgccgacgtg
gatctggagagcgagaagtttcggcgcctgggcgagatgcgcttcactctaggcgcctgc
ctgcgcctggtggccctgcgcacctaccggggcagcctggcctacctgcccgcagaaacg
ctggcttccaggaggggcccctccccggctctggccccgcaggaccccgcggacacccat
gtggtgcccctggagcagccagtgcctcctcactggacggtggtgccggagcaggacttt
gtgctggtgttagcactcctgcattcccacctggccagtgaccttttcaccgcccccatg
ggccgctgttcggctggcgccatgcatctgttctacgtgcgtgctggcgtgtcccgggcc
atgctgctgcgcctcttcctggccatggagaaaggcaggcacatggagtgccactgcccc
cacctggtctatgtgcctgtggttgccttccgcctggagcccaaggatgggaagggtgtg
tttactgtggatggggaactgctgatcagcgaggctgtccagggccaggttctccccaac
tacttctggatggtcagtggctacagggagcccccaccctctctgaaaccacagccctca
ccccgcaggaagtctcagcagacgctgcccccatcagagcgtccctga

DBGET integrated database retrieval system