KEGG   Bos taurus (cow): 618793
Entry
618793            CDS       T01008                                 

Gene name
FOXO4
Definition
(RefSeq) forkhead box protein O4
  KO
K12358  forkhead box protein O4
Organism
bta  Bos taurus (cow)
Pathway
bta04014  Ras signaling pathway
bta04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    618793 (FOXO4)
   04068 FoxO signaling pathway
    618793 (FOXO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    618793 (FOXO4)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    618793 (FOXO4)
SSDB
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg SAND
Other DBs
NCBI-GeneID: 618793
NCBI-ProteinID: NP_001094747
BGD-bta: BT18164
Ensembl: ENSBTAG00000004879
VGNC: 29100
UniProt: A6QLP0
Position
X
AA seq 512 aa
MDPVNENSAREAAAIVDLDPDFEPQSRPRSCTWPLPRPELAPEPSEASEVESGLGEKVHP
EGRSDGRTQPTLLPARLPDSAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIES
APEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSS
WWMLNPEGGKSGKAPRRRAASMDSSSRLLRGRSKTPKKKPAVLPAPREGATPRSPAGHFA
KWSGSPCSRNREEADAWSTFRPRSSSNASTVSTRPSPREPEPEVLAEEEMPASASGYAGG
VPPTLKEDLELLDGLNLTSPHSLLSRSSLSGFSLQHPGVPGPLHTYSTSLFSPAEGPLSA
GEGCFSSSQSLEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGIPSSSKLGTGGGLC
PKPLEAAGPSGLVPTLPMIAPAPPPVMGGAPVPKPLGAPVLTPPTEAPSQDRMPQDLDLD
IYMENLECDMDNIINDLMDGDEGLDFNFEPDP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggatccagtaaatgagaattcagccagagaggctgccgcgatcgtagacctcgatccc
gacttcgaaccccagagccgtccccgctcctgcacctggccccttccccgaccagagctc
gctcccgagccgtccgaggcgtccgaggtggagtcaggtctgggagagaaggtacacccg
gaggggcgctcggacgggcgcacccagccgaccctgttgcccgccaggctcccagactcg
gcagggggtccccagcccgggatcctgggggctgtaacaggtcctcggaagggaggctcc
cgccgaaatgcctggggaaatcagtcatatgcagaactcatcagccaggccattgaaagc
gcccccgagaagcgactgacactggcccagatctatgagtggatggtccgcacggtgccc
tacttcaaggacaagggtgacagcaacagctcagcaggatggaagaattcgatccgccac
aacctatccctgcatagcaagttcatcaaggttcacaacgaggctactggcaagagctcc
tggtggatgctgaatccggagggaggcaagagcggcaaggcaccccgccgccgggcagct
tccatggatagcagcagcaggctgctccggggccgcagcaaaacccccaagaagaaacca
gctgtgctgcccgctccacgtgaaggtgccactccaaggagccctgctggccactttgcc
aagtggtcaggcagcccttgctctcgaaaccgagaggaagccgatgcatggagcaccttc
cgtccacgaagcagttcgaatgccagcactgtcagcacccggccctcccccagggagccg
gagcctgaggtgctggcagaagaggaaatgccagcctcagccagtggctatgcagggggt
gtccctcccaccctgaaagaagatctggagctgttagatgggctcaatctcacatctccc
cactcgctgctgtctcggagcagcctctctggcttctctttgcagcatcctggggttccg
ggccccttacacacctacagcacctctctcttcagcccagcagaggggcccctgtcagca
ggagaagggtgcttctcaagctcccagtctttggaggctctgctcacctctgatacacca
ccacctcctgccgatgtcctcatgacccaggtagatcccattctgtcccaggctccaaca
cttctgctgctgggggggataccttcctccagtaagctaggcacggggggtggcctgtgt
cctaaacccctagaggctgcaggccccagcggtctggttcccaccctcccgatgatagca
ccagcaccacctccagtcatggggggggccccggtccccaagcccctgggggctcctgtg
ctcacacctcctactgaagctccaagccaagaccgaatgcctcaggatcttgatctcgac
atatacatggagaacctggagtgtgacatggataacatcatcaatgacctcatggatggg
gacgaaggactggacttcaactttgagccagatccctga

DBGET integrated database retrieval system