KEGG   Bos taurus (cow): 767877Help
Entry
767877            CDS       T01008                                 

Gene name
CCDC152
Definition
(RefSeq) coiled-coil domain-containing protein 152 isoform X1
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3394
Motif
Other DBs
NCBI-GeneID: 767877
NCBI-ProteinID: XP_005221619
BGD-bta: BT15839
Ensembl: ENSBTAG00000033221
VGNC: 26857
Position
20
AA seq 263 aa AA seqDB search
MNQNSEGCMKKISSVNLDKLINDFSQIEKKMIESSGKNNILDMQLEKANCLLRVMQTKEV
AMKQECATLHDMIKGLQHTIEYQHNLKGENEQLKRNADLMKEKFKMHEQEHRNNIAKLMS
EMKIKEEGHKIEKTKLYQDMQKKVKLSEEKNKELIEKKELEISELNAKLRTQEREKQNEM
IKLQLEFDAKLARVQTKTKSYPDSTVSPHSIYKRKLQHLQEEKDKEIAVLRNTVRDLEQR
LSVSKDSQVKLVGKDPRFKRRRF
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaaacagcgaaggatgtatgaaaaagattagcagtgtgaatcttgacaaactt
ataaatgacttttcacagatagaaaagaaaatgatagaatccagtgggaagaacaatatc
ctggatatgcagttggaaaaagctaactgtttattaagagtaatgcaaacaaaagaggtc
gcaatgaaacaagaatgtgctactcttcatgatatgataaaagggctacagcataccatt
gaatatcaacataatttgaagggtgaaaatgaacaactaaaaagaaatgctgatcttatg
aaagaaaagtttaaaatgcatgaacaggaacataggaataatattgccaaacttatgagt
gaaatgaaaatcaaagaggagggacataagattgaaaaaacaaaactttatcaagatatg
cagaaaaaagtcaaattaagcgaagaaaagaataaagaactgatagagaaaaaggagttg
gaaatttccgagttaaatgcaaagttaagaactcaagaaagggaaaaacaaaatgaaatg
atcaaactacagctagagtttgatgccaagctagcaagagttcaaactaaaacaaaatca
tatccagattctactgtttcaccacacagtatctacaaaaggaaacttcaacatcttcag
gaagaaaaagacaaggagattgcagttcttcgtaataccgttcgtgatttagaacaacgc
ctctctgtcagcaaagattctcaagttaaacttgttggcaaagatcctcgctttaaacgt
agacggttttga

DBGET integrated database retrieval system