KEGG   Bos taurus (cow): 768208Help
Entry
768208            CDS       T01008                                 

Gene name
AOAH
Definition
(RefSeq) acyloxyacyl hydrolase precursor
  KO
K01065  acyloxyacyl hydrolase [EC:3.1.1.77]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    768208 (AOAH)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.77  acyloxyacyl hydrolase
     768208 (AOAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_GDSL SapB_2 Lipase_GDSL_2 CLU_N
Motif
Other DBs
NCBI-GeneID: 768208
NCBI-ProteinID: NP_001071564
BGD-bta: BT17544
Ensembl: ENSBTAG00000018119
VGNC: 25971
UniProt: Q08DV1
Position
4
AA seq 575 aa AA seqDB search
MKSPRKLIMAAPVFFLLTLHTLASSGYGNWPDTRHSNGHACIGCVLVVSMIEQLTQVHNS
TVQISMERLCSYLPEKLFLKTTCYLVVHIFGPDITKLFRADMNADVVCHTLEFCKQDPGQ
PLCHLYPLPKEAWTFTLEKARQIVKRSPALTYSRSGAGICSLPFLAKICQKIKLSIQNSV
PFKDADSDKYSDFPTLRGFYWRGRDCNDSNKMAYPGRRPDNWDSYQDSNCNGIWGVDPKD
GIPYEKKFCEGSQPRGVILLGDSAGAHFHIPPDWITASQMSLKSFLNLPIALTNELDWPQ
LSGTTGFLYSTSRIKENSIYLRLRKRNHCNHRDYQNISKNGASSQNLERFIESLSRNQLL
DYPAIVIYAMIGNDVCSGNIDPLPEMTTPEKLYSKVMQTLQYLDSHLPNDSHVILYGLPD
GRFLWDHLHDRYHPLGQLNKDVTYAHFYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQL
SKTLKKIATSQKFTNFDLFYLDFDFQEITEEWQRRGGQPWQLIEPVDGFHPNEVVLQLLA
DHFWKKMQHQWPHVLGKENPFNPQIEQVFGDQGGH
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcctcggaaactcattatggctgctcctgtgttttttctcctgacccttcac
accttggcctcttcaggctatggcaactggcctgacaccagacactccaatggccatgcc
tgcataggttgtgtgctggtggtgtctatgattgaacagctcactcaagttcacaactcg
acagtccagatctcaatggagagactgtgcagctacttgcctgaaaaactgttcttgaag
accacttgctatttagtggtacatatatttggaccagacatcacaaaactattcagagca
gatatgaatgctgatgtggtgtgtcacaccctggagttttgtaaacaggatcccggccaa
cccttgtgtcacctctatccccttcccaaggaggcatggacatttacacttgagaaggcc
agacagattgtcaagagatctccagctctgacgtactccagaagtggtgctggtatttgt
tcactcccatttttggccaagatctgtcagaagattaaactaagtatacaaaattctgtg
ccattcaaagatgccgattcagacaaatatagtgatttcccaacactgcggggcttttat
tggcgagggagagattgcaacgacagcaacaagatggcatacccaggcagaaggccagac
aactgggactcatatcaagattcaaactgtaacggcatttggggtgttgatccaaaagat
ggaatcccatacgagaagaaattctgtgaaggttcacagcccaggggagtcattttgctg
ggggactcagctggggctcatttccacatccctcctgactggatcacagcttcgcagatg
tctttgaaatccttcctcaatttaccaatagctcttaccaatgagcttgactggccccag
ctatctggtactactggatttctgtactccaccagcagaattaaagaaaactctatttac
cttcgtttacggaaaagaaaccactgcaatcacagggactatcagaatatttcaaaaaat
ggtgcatcctcccaaaacctggagagatttatagaaagtttatctaggaaccagctgttg
gattatccagccattgtcatatatgccatgattggaaatgatgtctgcagtgggaatatt
gatcctctcccagaaatgaccactcctgagaaattgtactccaaggtcatgcagactctg
cagtatctagattcccacctgccaaatgacagtcatgttattttatatggcttaccagat
ggaagatttctctgggatcatttgcatgacagatatcatcctcttggccagctcaacaag
gacgtgacctacgcgcacttctactccttcctcaactgtctccaggtcagcccctgccat
ggctggatgtcttccaacaagacgctgcggactctcacttcagagagagcagaacaactc
tccaaaacgctgaaaaaaattgcaaccagccagaaatttacaaacttcgaccttttctac
ttagatttcgacttccaagaaatcacggaggagtggcaaaggagaggtgggcagccttgg
cagctcatcgaacctgtggatggatttcaccctaatgaggtggttttacagctgttggca
gatcacttctggaagaagatgcagcaccagtggccccacgtcctgggaaaggagaatcca
ttcaatccgcagattgagcaggtgtttggagaccaaggggggcactga

DBGET integrated database retrieval system