KEGG   Bos taurus (cow): 768242Help
Entry
768242            CDS       T01008                                 

Gene name
ABHD12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bta01002]
    768242 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    768242 (ABHD12)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     768242 (ABHD12)
Peptidases [BR:bta01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   768242 (ABHD12)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   768242 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Thioesterase Peptidase_S15 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 768242
NCBI-ProteinID: NP_001071584
BGD-bta: BT16764
Ensembl: ENSBTAG00000001420
VGNC: 25490
UniProt: Q08DW9
Position
13
AA seq 398 aa AA seqDB search
MRKRTEPVALEHERRTASGSPSAGPAAAALDADCRLKQNLCLAGPGPAEPRCAADAGMKR
ALGRRKGLCFRLRKILFFVLGLYVAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKRPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPTVWWKNAQGKDQMWYEDALSSSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKVRSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIQFANDENVKHISCSLLILHAEDDPVVPFQLGRKLYNIAAPSRSFRDFKVQ
FIPFHSDLGYRHKYIYKSPELPRILREFLGKSEPGRQH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcggaccgagcccgtcgccctggagcatgaacgccgtaccgcctcgggctcg
ccctccgccggcccggccgccgcggcgctggacgccgactgccgcctgaagcagaacctg
tgcctagcgggccctgggccggccgagccgcgctgcgccgcggacgcgggcatgaagcgg
gcgctgggcaggcgaaagggcctgtgcttccgactgaggaagatactcttctttgtcctg
ggattgtatgtggccattccatttctcatcaaactatgtcctgggatacaggccaaactg
attttcttgaatttcgtgcgggttccctatttcattgatttgaaaagaccacaggatcaa
ggtttgaatcacacctgtaattactacctccagccagaggaagacgtaaccattggagtc
tggcacacggtccccactgtctggtggaagaatgcccaggggaaggaccagatgtggtac
gaggatgccctgtcttccagccacccgatcatcctgtacctgcatgggaacgcgggcacc
agaggcggcgaccaccgggtggagctttacaaggtgctgagttccctcggctaccacgtg
gtcacctttgactacagaggttggggtgactcagtaggaacgccgtcggagcggggcatg
acgtatgatgcactccatgtttttgactggatcaaagtgcgaagtggagacaaccctgtg
tatatttggggccattctcttggcaccggagtggccacaaacctggtgcggcgcctctgt
gagcgagagactcctccagatgccctcatcttggaatctccattcactaatatccgtgaa
gaagccaagagccatccgttctcagtgatctatcgatatttccctgggtttgactggttc
ttccttgatcccatcacaagcagtggaattcagtttgcaaatgatgaaaatgtgaagcac
atctcctgctccctgctcatcctgcatgccgaggacgacccggtcgtgcccttccagctc
ggcagaaagctctacaacatcgccgcaccgtcacgcagcttccgggactttaaggttcag
ttcatccccttccactcggaccttggctacaggcacaagtacatctacaagagccccgag
ctcccgcggatcctgagggagttcctggggaagtcggaaccgggacgccagcactga

DBGET integrated database retrieval system