KEGG   Bos taurus (cow): 781106
Entry
781106            CDS       T01008                                 
Symbol
NEGR1
Name
(RefSeq) neuronal growth regulator 1 precursor
  KO
K06775  neuronal growth regulator 1
Organism
bta  Bos taurus (cow)
Pathway
bta04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    781106 (NEGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bta04515]
    781106 (NEGR1)
Cell adhesion molecules [BR:bta04515]
 Immunoglobulin superfamily
  IgLON family
   781106 (NEGR1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig V-set Ig_5 Izumo-Ig Ig_4 C2-set_2 V-set_CD47 Herpes_gE_N
Other DBs
NCBI-GeneID: 781106
NCBI-ProteinID: NP_001192343
BGD-bta: BT29424
Ensembl: ENSBTAG00000055278
Position
3:72811994..73846989
AA seq 354 aa
MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRC
YLEDGASKGAWLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGLYTCSV
QTQHTPRTMQVHLTVQVPPKIYDISHDMTINEGTNVTLTCLATGKPEPSISWRHISPSAK
PFENGQYLDIYGITRDQAGEYECSAENDVSFPDVKKVKIVVNFAPTIQEIKSGTVAPGRS
GLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAV
NKLGTTNASLPLSPPSTAQYGITGSADVLFSCWYLVLTLSSFTSLFYLKNAILQ
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggacatgatgctgttggtgcagggtgcttgttgctcgaaccagtggctggcggcggtg
ctcctcagcctgtgctgcctgctaccctcctgcctcccggctggacagagtgtggacttc
ccctgggcggctgtggacaacatgatggtcagaaaaggggacacggcggtgcttaggtgt
tatttggaagatggagcttcaaagggtgcctggctgaatcggtcaagtattatttttgcg
ggaggtgataagtggtcagtggatcctcgagtttcaatttcaacattgaataaaagggac
tacagcctccagatacagaatgtagatgtgacagatgatggcctgtacacatgttctgtt
cagactcagcatacaccaagaacaatgcaggtgcatctgactgtgcaagttcctccgaag
atttatgacatctcacacgatatgaccatcaatgaaggaaccaatgtcacccttacttgt
ttggccactgggaaaccagagccttccatttcttggcggcacatctctccatcagcaaaa
ccatttgaaaacggacaatatttggacatctatggaattacaagggaccaggctggagaa
tatgaatgcagtgcagaaaatgatgtgtcattcccagatgtgaaaaaagtgaaaattgtc
gtaaactttgctcctacaattcaggaaattaaatctggcaccgtggcccccggacgcagt
ggattgataagatgcgaaggtgcaggtgtgccgcctccggcctttgaatggtacaaaggg
gagaagaagctcttcaatggccaacaaggaattatcattcaaaattttagcacaagatct
attctcactgttaccaatgtgacacaggagcacttcggcaactatacttgtgtggctgtc
aacaagctaggcacaaccaacgcgagcctgcctctcagccctccaagtacagcccagtat
ggaattaccgggagcgctgacgttcttttctcctgctggtaccttgtgttgacactgtcc
tctttcaccagcttattctacctgaagaatgccattctacaataa

DBGET integrated database retrieval system