KEGG   Bos taurus (cow): 781644
Entry
781644            CDS       T01008                                 

Gene name
LXN
Definition
(RefSeq) latexin
  KO
K23594  latexin
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    781644 (LXN)
Peptidases and inhibitors [BR:bta01002]
 Peptidase inhibitors
  Family I47: latexin family
   781644 (LXN)
SSDB
Motif
Pfam: Latexin
Other DBs
NCBI-GeneID: 781644
NCBI-ProteinID: NP_001073809
BGD-bta: BT15514
Ensembl: ENSBTAG00000009336
VGNC: 31087
UniProt: Q0VCI7
Position
1
AA seq 222 aa
MEIPPTHYPAARAASVVESCINYQQGTPHKLFLVQTVEQVSLEDIPGRGHKYRLKFSVEE
IIQKEVTVNCTAEVLYPPTGQDTAPEVNFTFEGEIGKNPDEEDNTFYQRLKSMKEPLDAQ
NIPDSFGNVPPEMKPVRHLAWVASGYIIWQNSTENTWYKMAKIQTVKQVQRNDDFIELDY
TILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEAQLE
NT seq 669 nt   +upstreamnt  +downstreamnt
atggaaatccctccgacccactacccggccgccagggcggcctcggtggtagagagctgc
atcaactaccagcaggggactccccacaagctgtttctggtgcagacagtcgaacaagtc
agcctggaggatattccaggaagaggacataagtaccgccttaaattttctgtggaagaa
attatccaaaaagaagttacagtgaactgcacagctgaagtactgtaccctccaacggga
caagatactgcaccagaagtcaacttcacatttgaaggagaaattgggaaaaacccagat
gaagaagataacacattttatcaaagactcaagtccatgaaggaaccactagacgcacaa
aatattccagacagttttggaaatgtacctccagaaatgaagccagttcgacatttagcc
tgggttgccagtggttatataatatggcaaaattctactgaaaatacatggtataaaatg
gcaaaaattcaaactgtcaagcaagtgcaaagaaatgatgacttcatcgagctagactac
actattctccttcatgacattgcatctcaggagattattccttggcaaatgcaagttctc
tggcatccacaatatggtactaaagtaaaacataatagccgtctgccaaaggaagcacaa
ttggaataa

DBGET integrated database retrieval system