KEGG   Bos taurus (cow): 781648Help
Entry
781648            CDS       T01008                                 

Gene name
LAP3
Definition
(RefSeq) cytosol aminopeptidase
  KO
K11142  cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5]
Organism
bta  Bos taurus (cow)
Pathway
bta00330  Arginine and proline metabolism
bta00480  Glutathione metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    781648 (LAP3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    781648 (LAP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    781648 (LAP3)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     781648 (LAP3)
    3.4.11.5  prolyl aminopeptidase
     781648 (LAP3)
Peptidases and inhibitors [BR:bta01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   781648 (LAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N PAW
Motif
Other DBs
NCBI-GeneID: 781648
NCBI-ProteinID: NP_776523
BGD-bta: BT10038
Ensembl: ENSBTAG00000005989
VGNC: 30786
UniProt: P00727
Structure
PDB: 

Position
6
AA seq 519 aa AA seqDB search
MFLLPLPAAARVAVRHLSVKRLWAPGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFN
KLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGS
EDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMD
LMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDSA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttcttgctgcctcttccggctgccgcgcgagtcgccgtccgacatctgagcgtgaag
cgtttgtgggcacccggtccagccgctgcagacatgacgaagggccttgttttaggaatc
tatagcaaagaaaaagaagaagatgagcctcagtttacaagtgcaggagagaattttaat
aaattggtgtctggaaagctgagagaaattttgaacatatctggaccacccctgaaggca
ggcaaaacccgaaccttttatggtctacatgaggacttccctagcgtggtggtggttggc
cttggcaaaaagacggctggaattgatgaacaggagaactggcatgaaggcaaagaaaac
atcagagctgctgttgcagcggggtgcagacagattcaggacctggagatcccgtcggtg
gaggtggacccctgcggagatgcccaggcggctgcggaaggagcggtgctcgggctctat
gagtatgatgacctgaagcagaaaaggaaggtggtggtgtcggccaaactccatggaagt
gaggaccaggaggcctggcagagaggcgtcctctttgcttctgggcagaacctggcacgc
cgcttgatggagacgcctgccaacgagatgacgccaaccaaatttgccgaaattgttgag
gagaatctcaaaagtgctagtattaaaacagacgtcttcatcagacccaagtcttggatt
gaggaacaggaaatgggatcatttctaagtgtggccaaagggtccgaagagcctccagtc
ttcctggaaattcactacaaaggcagtcccaatgcaagtgaacctcccttggtgtttgtt
gggaaggggattacctttgacagtggtggcatctccatcaaggctgctgcaaacatggac
ctcatgagggccgacatgggaggagctgccactatctgttcagccatcgtgtctgctgcc
aagctcgacctgcccatcaacatcgtaggtttggctcctctttgtgaaaatatgcccagt
gggaaggccaacaagcctggggatgttgttagagccaggaacgggaagaccatacaggtg
gataacaccgatgctgaggggagacttatcctggccgatgcgctctgctacgctcacact
tttaacccaaaggtcatcattaatgccgccaccctgacaggtgccatggacatagctttg
ggatctggtgccactggggtctttaccaactcttcttggctgtggaacaaactatttgag
gccagcattgaaacaggagaccgtgtctggaggatgcctctctttgaacattacacaaga
caggttatagattgccaacttgctgatgttaataacattggaaaatatagatctgcagga
gcgtgtacagctgcagcattcctgaaagaatttgtgactcatcctaagtgggcacattta
gacatagcaggtgtgatgaccaacaaagatgaggttccttatcttcgcaaaggcatggct
gggaggcccacgaggaccctgattgaattcctgtttcggttcagtcaagacagtgcttag

DBGET integrated database retrieval system