KEGG   Bos taurus (cow): 782887Help
Entry
782887            CDS       T01008                                 

Gene name
SETD1A
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
bta  Bos taurus (cow)
Pathway
bta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    782887 (SETD1A)
Enzymes [BR:bta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     782887 (SETD1A)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     782887 (SETD1A)
   HMT complexes
    COMPASS/SET1 complex
     782887 (SETD1A)
    COMPASS/SET1 complex (yeast)
     782887 (SETD1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 Topoisom_I_N
Motif
Other DBs
NCBI-GeneID: 782887
NCBI-ProteinID: NP_001192362
BGD-bta: BT15100
Ensembl: ENSBTAG00000002345
VGNC: 34492
Position
25
AA seq 1708 aa AA seqDB search
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGIHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATETTDSRRRSSSDTAAFPAGSAVVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSAAICATTAATASASSSSSLSSSSSSSSSSSSSHFRG
SDSNYPAYYESWNRYQRHASYPPRRATRDEPPGASFAENTAERFTPSYTSYLPPEPNRPA
DQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNESVP
FAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSSTGPGARDTGSEAPSGSGHGPCTP
PPAPASFEDVAPTGSGEPGATRESPKANGQNQASPCSSGEDMEISDDDRGGSPPPAPTPP
QQPPPPPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPPEYPPPPPPPPHIYDFVN
SLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTAASAGPPGGAFGEAFLPFPPH
QEAAYGLPYALYAQGQEGRGAYSREAYHLPLPMAAEPLPSSVSGEEARLPPREEAELAEG
KALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAK
QQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSE
ISEASEEKRPRPSTPAEEDEDDAEREKEVGEPGRPGTKPPKRDEERSKTQGKHRKSFALD
SEGEEASQESSSEKDEEDEEEDEEDEEREEAMDAAKKETEASDGEDGESDSSSKCSLYAD
SDGENDSTSDSESSGSSSSSSSSSSSSSSSSSSSSSESSSEEEEEEEQPAIILAALSPPR
DVPTPLSAPAEEPEPERVEDSPVTPLPEQEKSPVRPAGSTEEPPSSAPQPPPEPPAGPLA
PIPRPDDRPSSPIPLLPPPKKRRKTVSFSAVEEAPAPEPPPAALPQAKSSGPASRKAPRA
VERTIRNLPLDHASLVKSWPEEVSRGGRNRAGGRGRSAEEEEAEPATEVDLAVLADLALT
PARRGLPALPAADDSEAAETPDEAERPGPLLSHILLEHNYALAVRPPLPPPPPPSTPAPR
PLEPVPAPAALFSSPADEVLEAPEVVVAEVEEPKQPPQQQEDGEEEEEEEEESESSESSS
SSSSDGEGATRRRSLRSHTRRRRPPPPPPPPPPPTFDPRSEFEQMTILYDIWNSGLDLED
MSYLRLTYERLLQQTSGADWLNDTHWVQHTITNLSTPKRKRRPQDGPREHQTGSARSEGY
YPISKKEKDRYLDVCPVSARQLEGVDTQGTNRVLSERRSEQRRLLSAIGTSAIMDSDLLK
LNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGI
GSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEE
ITYDYKFPLEDNKIPCLCGTESCRGSLN
NT seq 5127 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggaaggtgggggagatgggcagaaggccccgagcttccagtggcggaactac
aagctcatcgtggatcctgccttggaccctgccctacgcaggccttctcaaaaggtgtac
agatacgatggaatccactttagtgtcaacgactcaaagtatataccagtggaggacctc
caagacccccgttgccacgtcaggtccaaaaacagagacttttccctcccagtccctaag
tttaagctggatgagttctatattggacagatcccactgaaagaagtgacattcgcaagg
ctgaatgacaatgtgcgggagaccttcctgaaggatatgtgccgaaagtatggtgaggtg
gaagaggtagagatccttctccacccccgtactcgcaagcacctgggcctggcccgcgtg
ctcttcaccagcactcggggagccaaggaaacagtcaaaaacctccaccttacctccgtc
atgggcaacatcatccatgcccagctcgacatcaaaggtcaacaacgaatgaaatactat
gaactgatagtcaacggctcctacacccctcagacggtgcccactgggggcaaggccctg
agtgagaagttccaaggctctggtgcagccacggagacgaccgactcccgccgccgctcc
tcgtcagacacagctgccttcccggcaggctcggctgtggtgggcactcccggcaatggc
accccctgctcccaagacacaagcttctccagcagccgacaggacaccccgtcttccttt
ggccagttcacccctcagtcctcccaaggaaccccctacacgtctcggggcagcaccccc
tactctcaggactctgcctactccagcagcaccacttcaacctccttcaagccccggcgg
tcagagaacagctaccaagattccttctcccgccgccatttctccgcctcttcggccccc
acaaccacctctgccgccatctgcgccaccactgcagccaccgcctccgcctcctcgtcg
tcctcgttgtcttcgtcctcttcgtcgtcctcttcgtcctcctcctctcactttcgtggt
tccgactcaaactacccagcatattacgaaagctggaatcgctaccaacgccatgcttcc
tacccaccccgccgggcaactcgggacgagccccccggggcctcttttgccgaaaatacc
gctgagcgcttcacgccatcctacacctcctacttgccccccgagcccaaccggcctgct
gaccaggactaccggcctcctgcctccgaagctccacccccagagcctccagaacctggt
ggaggagggggcggcggggggcccagccccgagagagaagaagctcgaacctccccgcgc
ccagcctcaccggcccgttctggctccccagccccagagaccaccaacgagagcgtgccc
ttcgctcagcacagcagcctggattcccgcattgagatgttgttgaaggagcagcgttcc
aagttttccttcctggcctctgacaccgaggaagaggaagagaacagcagcacaggcccg
ggggctcgggacacaggaagcgaggccccttctgggtctggtcacgggccctgcacaccc
cctccagccccggcgagttttgaggatgtggcacctacagggagtggagaaccaggagct
acccgggagtcgcccaaggccaatggacagaaccaggcttctccatgctcttccggagag
gacatggaaatctccgacgacgacaggggcggctcaccccctccggccccgacacccccc
cagcaacctccaccccctccgccgccacctcccccaccccctccttacctggcttccctt
ccccttggttatcctccccaccagcctgcctacctcctccccccgcgacccgacgggccg
ccgcctcccgagtacccccctcctcctccgccacccccccacatctatgactttgtgaac
tccttagagctcatggatcgacttggggctcagtggggaggaatgcccatgtccttccag
atgcagacccagatgttaactcggctccaccagctgcggcagggcaaaggattgaccgcg
gcctcagcgggtccccccggtggggcctttggggaggccttcctcccattcccaccccac
caagaggcggcctacggcctaccatacgctctgtacgctcaagggcaagaaggccgaggg
gcatactcccgggaggcctaccacctgcctttgcccatggcagccgagcccctgccctcc
tcagtctcaggagaagaggcccggctgcccccccgggaggaagcagagctggccgagggc
aaggccctaccctcggcaggcaccgtgggccgtgtactggccaccctggtccaggagatg
aagagcatcatgcagcgagacctcaaccgcaagatggtggagaacgtggcctttggagcc
tttgaccagtggtgggagagcaaggaagagaaggccaagccattccagaatgcagctaaa
cagcaagccaaggaggaggataaagagaagacaaagctcaaagagccaggcctgctgtcc
ctcgtagactgggccaagagtggcggtaccaccggcatcgaagccttcgcctttggatca
ggactgcgaggggccctgcggctgccttctttcaaggtaaagcgaaaagagccttcggaa
atttcagaggccagtgaggaaaagaggccccggccttctactccagctgaggaagatgaa
gatgatgctgagcgagagaaggaggttggagagccaggccgtccggggaccaagcccccg
aaacgagatgaagagcgaagcaagacccagggcaagcaccgcaagtcttttgctctggac
agcgaaggggaggaagcatcccaggagtcctcctcagagaaggatgaggaggatgaagag
gaagatgaagaagatgaagagcgtgaggaagccatggatgctgcaaagaaggagacagaa
gcatcagacggcgaggacggggaaagcgattcgtcctccaaatgttctctgtatgctgac
tcagatggtgagaacgatagcacgtcggactctgagagcagcggttcctccagctcctcg
tcttcttcatcttcttcgtcttcatcctcgtcctcctcctcctcatctgagtcctcctcg
gaagaagaagaggaagaggagcaaccagcaatcatactcgcagcattgtcgccccctaga
gatgtccccacgcccctgtcagcacctgcagaggagcccgagccagaaagggttgaagac
tccccagtcacacctctccccgaacaggagaagtctcctgtgagacctgcaggttccact
gaggaaccgccttccagtgcaccccagcctcccccagagccaccagctggacccctggcc
cccatcccccgccccgacgatcgcccctcctctcccatccctctcctacccccacccaag
aaacgccggaaaaccgtctccttctctgcggtggaggaggcaccagccccagagcctccc
cccgccgccctgccacaggccaagtcctccggccctgcctctcgcaaagccccccgggct
gtggagcggaccattcgcaacctgcccctcgaccacgcctctctggtcaagagttggccc
gaggaggtgtcccgaggaggccggaaccgggccggaggccggggccgctccgccgaggaa
gaggaggctgaaccggccacagaagtggacctggccgtgctggctgacctggccctgacc
ccagcacggcgtggcctgcccgctctgcccgccgccgacgactcggaggccgcggagaca
ccggacgaggccgagcgcccgggtcccctgctcagccacatcctcctggagcacaactac
gccctggccgtcaggccgccgctgccgcccccgccgccaccctccacgcctgctcctcgt
cccttggaacccgttccggcccccgcggccctcttcagctccccggcagacgaggtcctt
gaggccccggaggtggttgtggccgaggtggaggagccaaagcagccaccacagcagcag
gaggacggagaggaggaggaggaagaggaagaggagtcggagtcatcggagagcagcagc
agcagcagcagcgacggcgagggcgccacccggcggcgcagcctccgttcgcacacgcgg
cgccggcggccgcccccacccccgcccccgccgccgccccccaccttcgatccccgcagc
gagtttgagcagatgaccatcctctatgacatttggaactcgggcctggacttggaggac
atgagctacctgcggctgacgtacgagcggcttctgcagcagactagtggggccgactgg
ctgaacgacacccactgggtccagcacaccatcaccaacctgagcactccgaaacgcaag
cggcggccccaagacgggccccgggagcaccagacaggctcagcccgcagtgaaggctac
taccccatcagcaagaaggagaaggaccggtacctggacgtgtgccctgtctcggcccgg
cagctggaaggagtggatactcaggggactaaccgcgtgctttcggagcgccggtcagag
cagcggcggctgctgagcgccattggcacctctgccatcatggacagcgatctgctgaag
ttaaaccagctcaagttccggaagaagaagctccgattcggccggagccggatccacgag
tggggactgtttgccatggaacccatcgccgctgacgagatggtcatcgaatacgtgggt
cagaacattcgccagatggtggccgacatgcgggagaaacgctacgtgcaggagggcatt
ggcagcagctacctgttccgggtagaccacgacaccatcatcgacgccaccaagtgcggc
aacctggcaaggttcatcaaccactgctgcacgcccaactgctatgccaaggtgatcacc
atcgagtcccagaagaagatcgtgatctactcgaagcagccgatcggcgtggatgaggag
atcacctacgactacaagttcccgctggaggacaacaagatcccgtgtctgtgcggcacg
gagagctgccgtggctccctcaactga

DBGET integrated database retrieval system