KEGG   Bos taurus (cow): 784623Help
Entry
784623            CDS       T01008                                 

Definition
(RefSeq) olfactory receptor 5B12
  KO
K04257  olfactory receptor
Organism
bta  Bos taurus (cow)
Pathway
bta04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    784623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    784623
G protein-coupled receptors [BR:bta04030]
 Others
  Chemoreception
   Olfactory
    784623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 784623
NCBI-ProteinID: XP_002707910
BGD-bta: BT13572
Position
15
AA seq 317 aa AA seqDB search
MIPRENSTVVIEFILAGITDDSQLQIPLFLVFTLIYLLTLVGNLGVITLILLDSRLHTPM
YFFLSNLALVDFGYSTAVTPKVMAGFLTGDKVISYNACVAQLFFFGGFLSVETFLLALMA
YDRHAAVCKPLHYTNIMTPRVCAWIVIGSYVFGFLEISVHTWNIFSLSFCRSYVIDHFFC
DATPLLALSCSKSNRSEMVLFLFVGFNVLLSNLVILVSYLFIFVTILRMRSSGGHQKAFS
TCASHLTAVSIFYGTASFMYFQPGSRHSMSTDKMASVFYAIVIPMLNPLIYSLRNKEVKR
VLKKAVGKAKSSLIFKI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatccccagggagaacagtacagtcgtgattgagttcattcttgccgggataactgat
gactcacaactgcagatcccactctttctagtgttcacactcatctacctcctcactctg
gttgggaacctgggggtgatcacgctgatcctgctggactctcgtctccacactcccatg
tacttcttccttagcaacctcgctctggtggactttggttactccacagccgtcactccc
aaagtaatggctggattcctcacgggagacaaggtcatttcctacaatgcttgtgttgct
cagctcttcttctttggtggctttctctctgtggaaacttttctcttggccttaatggcc
tatgaccgtcatgcagcagtgtgtaaaccactccattacaccaacatcatgacaccaagg
gtgtgtgcctggattgtcatagggtcttatgtctttggtttcctagaaatctctgtgcac
acttggaacatattcagtctgtctttctgcagatcatatgtaattgatcactttttctgt
gatgctactcctctcctggctctctcatgctccaaaagcaacagaagtgagatggtttta
tttctttttgttggcttcaatgtccttctttctaacctggtcatcctggtctcctatctg
tttatctttgtcaccattctgaggatgcgctcatctggaggacatcagaaagccttttcc
acctgtgcttcccacctcactgctgtctccatcttttatgggacagcttctttcatgtac
tttcagcccggctcccgccattccatgagcacagacaaaatggcatctgtgttctacgcc
atagtcatccccatgctgaatcctctgatctatagtctgaggaacaaagaggtcaagagg
gtgctaaaaaaagctgtggggaaggcaaagtcttctctaatattcaaaatttaa

DBGET integrated database retrieval system