KEGG   Bos taurus (cow): 785179Help
Entry
785179            CDS       T01008                                 

Gene name
FKBP1B
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1B
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bta03110]
    785179 (FKBP1B)
Enzymes [BR:bta01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     785179 (FKBP1B)
Chaperones and folding catalysts [BR:bta03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    785179 (FKBP1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 785179
NCBI-ProteinID: NP_001091627
BGD-bta: BT11589
Ensembl: ENSBTAG00000003409
VGNC: 29021
UniProt: P68107
Position
11
AA seq 108 aa AA seqDB search
MGVEIETISPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGF
EEGAAQMSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtggagatcgagaccatctccccgggagacggaaggacgttccccaagaagggc
cagacgtgcgtggtgcactacacaggaatgcttcaaaatggcaagaaattcgattcatcc
agagacagaaacaagcctttcaagttcagaattggcaaacaggaagtcatcaagggtttt
gaagagggcgcagcccagatgagcttggggcagagggcgaagctgacctgcactcccgat
gtggcatatggagccacaggccaccccggtgtcatccctcccaatgccaccctcatcttt
gacgtggagctgctcaacctagagtga

DBGET integrated database retrieval system