KEGG   Bos taurus (cow): 785909Help
Entry
785909            CDS       T01008                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04921  Oxytocin signaling pathway
bta05410  Hypertrophic cardiomyopathy (HCM)
bta05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
bta05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    785909 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    785909 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    785909 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    785909 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    785909 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    785909 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    785909 (CACNA2D2)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   785909 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 dCache_1 VWA_2 dCache_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 785909
NCBI-ProteinID: XP_024839037
BGD-bta: BT14240
Ensembl: ENSBTAG00000009489
VGNC: 26680
Position
22
AA seq 1147 aa AA seqDB search
MAVPARTCGASRPDPARTALRWPSRGSRLGPGARRPAAGPPRPLALLLPPLLLLPLLAAP
GASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAETFQKAHRWQDNIKEEDIVYYDAKADAELDDPESED
VERGSKASTLRLDFVEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFME
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNPNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACTNKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KEAKQVQWTNVYEDALGLGMVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMI
DGNKGHKQIRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQI
LQVKYFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNN
FLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFATTDGGITRVFPNKAAEDWTENPEP
FNASFYRRSLDNHGYVFKPPQQDALLRPLELENDTVGILVSTAVELSLGGRTLRPAVVGV
KLDLEAWAEKFKVLASNRTHQDQPQKQCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSN
QNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPLPPGSLGAAPRGIFVPT
IADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGNPEVRESSCVMKQTQYYFG
SVNASYNAIIDCGNCSRLFHAQRLINTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQC
ELVQRPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVH
AHPSRRL
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcctctcggcccgacccggcgcggactgcgctc
cgatggcccagccgcggctcccggctcggccccggcgcccggcgcccggcggcgggtccc
ccgcgcccgctggcgctgctcctgccgccgctgctgctgctcccgttgctcgccgccccc
ggcgcctcagcctacagctttcctcagcagcacacgatgcagcactgggcccggcgcctg
gagcaggagattgatggtgtgatgcgaatctttgggggcgttcagcagctccgtgagatc
tacaaggacaacaggaatctgtttgaggtgcaggagaatgagcctcagaagctggtggag
aaggtggcgggggacattgagagcctgctggacaggaaggtgcaggccctgaagagattg
gctgatgctgcagagaccttccagaaagctcaccgctggcaggacaacatcaaggaggaa
gacattgtgtactatgacgccaaagctgatgctgagctggacgaccctgagagtgaggat
gtggaaaggggatccaaggccagcaccctccggctggacttcgttgaggactcaaacttc
aagaacaaggtcaactattcatacacagccgtgcagatccccacggacatctacaaaggc
tccaccgtcatcctcaatgagctcaactggacagaggccctggagaatgtgttcatggag
aaccgcaggcaggaccccacgctcctgtggcaggtctttggcagcgccacgggagtcact
cgctactatccagctacgccgtggcgagcccccaagaaaatcgacctgtacgatgtccga
aggagaccctggtatatccagggggcctcatcgcccaaggacatggtcatcatcgtggat
gtgagtggcagtgtgagtggcttaaccctgaagctgatgaagacgtcagtctgtgagatg
ctcgacacgctctccgacgacgactatgtcaacgtggcctcgttcaatgaaaaggcacag
cctgtgtcatgcttcacacacctggtgcaggccaacgtgcgtaacaagaaggtgttcaag
gaagctgtgcagggcatggtggccaagggcaccacggggtacaaggccggctttgagtac
gccttcgaccagctgcagaaccccaacatcactcgtgccaactgcaacaagatgatcatg
atgttcacggatggcggtgaggaccgcgtgcaggacgtctttgagaagtacaactggccc
aaccggacggtgcgcgtgttcactttctccgtggggcagcacaactacgacgtcacaccg
ctgcagtggatggcctgcaccaacaaaggttactattttgagatcccttccattggtgcc
atccgcatcaacacgcaggaatatcttgacgtattgggcaggcccatggtgctggcgggc
aaggaggccaagcaggtgcaatggactaatgtgtacgaggatgcactggggctggggatg
gtggtgacagggaccctccctgttttcaacctgacacaagacggccctggggaaaagaag
aaccagctgatcctgggcgtgatgggcatcgatgtggctctgaatgacatcaagaggctg
actcccaactacacacttggagccaacggctacgtatttgccattgacctgaatggctac
gtattgcttcacccgaacctcaagccccagaccaccaacttccgggagcctgtgaccctg
gacttcctggatgcagagctggaggatgagaacaaggaggagatccgcaggagcatgatc
gatggcaacaagggccacaaacagatcagaaccctggtcaagtccttggacgagaggtac
atagacgaggtgacgcggaactacacctgggtgcccataaggagtaccaactacagcctc
gggctcgtgcttccaccctacagcaccttctacctccaagccaacctcagcgaccagatc
ctacaggtcaagtattttgagttcctgctccccagcagctttgagtctgaaggacatgtt
ttcattgctcccagagagtattgcaaggacctgaatgcctcagacaacaacaccgagttc
ctgaaaaacttcattgagctcatggagaaagtgactccagactccaaacagtgcaacaac
ttcctcctgcacaacctgatcctggacacaggcatcacacagcagctggtggagcgcgtg
tggcgggaccaggatctcaacacgtacagccttctggccgtgtttgccaccaccgacggt
ggcatcactcgagtgttccccaacaaggcagctgaagactggacagagaaccccgagccc
ttcaacgccagcttctaccgccgcagcctggacaaccacggctatgtcttcaagcccccc
cagcaggatgccctgttaaggcctctggagctggagaatgacacggtgggcatccttgtc
agcacagctgtggagctcagcctgggtggacgtacgctgaggccagcagtggtaggcgtt
aagctggacctagaggcctgggctgagaagttcaaggtgctagccagcaaccgtacccac
caggaccagcctcagaagcagtgtggccccaacagccactgtgagatggactgcgaggtt
aacaatgaggacctgctctgtgtcctcattgatgatgggggattcctggtgctgtcaaac
cagaaccatcagtgggaccaggtgggcaggtttttcagtgaagtggatgccaacctgatg
ctggcactctacaataactccttctacacccgcaaggagtcctacgactatcaggcggcc
tgtgcccccttacccccgggcagcctgggtgctgcaccccggggcatctttgtgcccacc
attgcagatttccttaacctagcctggtggacgtctgctgcagcctggtctttgttccag
caacttctctatggtctcatctaccacagctggttccaggcagaccccgcggaggccgag
gggaaccccgaggtgcgcgagagcagttgcgtcatgaaacagacccagtactacttcggc
tcggtgaacgcctcctacaacgccatcatcgactgcggaaactgctccaggctcttccac
gcgcagagactgatcaacaccaaccttctcttcgtggtggccgagaagccgctgtgcagc
cagtgtgaagccggccggctactgcagaaagagacacactcggacggcccggagcagtgt
gaactggtgcagagaccgcgataccggagaggcccacacatctgtttcgactacaacgcc
acggaagatacctcagactgtggccgcggagcctccttccccccgtcgttgggcgtcctg
gtgtccctccagctgctgctcctcctgggcctgcctccccggccacagcctcaagtccat
gcccacccctctcgccgactctga

DBGET integrated database retrieval system