KEGG   Bos taurus (cow): 787488
Entry
787488            CDS       T01008                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X8
  KO
K15195  AF4/FMR2 family member 3
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bta03021]
    787488 (AFF3)
Transcription machinery [BR:bta03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     787488 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 787488
NCBI-ProteinID: XP_002691193
Position
11
AA seq 1382 aa
MAPQKGARAAGSSLLVALALLWVRGGWLHAWWGNAIGWFSHSPPHFHILYQHLHTSVVTT
CTLPVYTESAIQKACQGEGSCTLSLRRKTLNNLIWEKKKKSVCVESARAARSSAAAATAA
TAAAALTPPTMDSFDLALLQEWDLESLWGEDILNQRNDSLVVEFQSSASRCRSVYEPDRN
VLRRKERERRNQEAQQDDGAFNSSYSLFSEPYKTNKGDELSNRLQNTLGNYDEMKDFLTD
RSNQSHLVGVPKPGVPQAPVTKIDEHFVADSRAQTQPASVCSTTSSTPAAVPGQQSKRGA
MGWQKAGHPPSDGQQRATQQGTLRTLLGDGVGRQQPRTKQVCNVEVGLQTQDRPPAMGAK
HSGNGHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKSSAETGVHCLYRG
VPATKSESARAKAKLSKFSIPKQGEESRSGETNSCVEEIIREMTWPPALAAIQPPGKVEP
SKFPFPNKDSQLASSGHNNPKKGDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQR
TALHALSDSAGLQPADCRASAPSSKGSSSGSSSSGSSSSSDSESSSGSDSETESSSSESE
GSKPPHYSSPEAEPASSNKWQLDKWLNKVNHHKPPVLIQNESHHGPESSQYYTPVKEDTQ
DCGKLPDVCPPGLRDKDIKGACKEEQRPRTANKAPGSKGVKQKSPPAAVAVAVTAAAAPP
PAVPGAPAESAPAPARRSAGKKPTRRTERTSAGDSGHRPEEPVAAEALGASTGVPPEPPK
PRPCGNSRTNHRKELRSAVTCEKRRTRGLSRIVPKSKEFIETESSSSSSSSDSDLESEQE
DYPLSKAVAAAAAAAAASGNDPRLKEAPSSISGGGPRAPVGSINARTTSDIAKELEEQFY
TLVPFGRNELLSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPAAKDSESAPPS
HASEAPVEKTLPKSKRKRKCDNEDDYREIKKAPGERESASRLSASANSTLSANHCSMNIN
SLAIPINKNEKVLRSPISPLSDASKHKFSGEDLTSSSRSNSNGLFTSTSSSKKHKAESQL
QSHAADLTKAAHNNSENILHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEA
KRMKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMR
LKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAP
SPWGASGKSTGTPSPMSPNPSPTGSVGSQGSLSNSNALSPSTIVSIPQRIHQMAANHVSI
TNSILHSYDYWEMADNLAKENREFFHDLDLLMGPVTLHSSMEHLVQYSQQGLHWLRNSAH
LA
NT seq 4149 nt   +upstreamnt  +downstreamnt
atggccccccagaagggggcccgggctgctggttccagccttctggtcgcccttgctctg
ctgtgggtgagaggaggctggctgcatgcctggtggggaaacgccattggctggtttagt
cactcgcctccacactttcacatcctctatcaacacctgcacacttcagtggtgaccaca
tgcactcttcctgtttatacggaaagtgccattcagaaagcttgccagggagaagggagc
tgcaccctcagcctcagaaggaagacgttgaacaacttaatttgggagaaaaagaaaaag
agcgtgtgtgttgagagcgcgcgggcggcccgatcctcggcggcggcggcgacggcggcg
acggcggcggcggcgctgacacctcccaccatggacagcttcgacttagccctgctccag
gaatgggacctcgagtcgctgtggggtgaagacatcctaaaccagaggaatgactctcta
gttgtggagtttcagtcatcagccagcagatgcaggagtgtctacgaaccggatagaaac
gtgttacggaggaaagaacgagaaagaagaaaccaggaagctcagcaggacgatggcgcg
tttaattcgagttactccctctttagtgaaccctacaagactaacaagggggatgagctc
tccaaccggctccagaacactttaggcaattacgatgaaatgaaagactttctcacggat
cgatcaaaccagagtcatcttgtgggtgttcccaaacctggggttcctcaggctcccgtg
accaagattgatgaacattttgtggcagattcaagagcccagactcagccagcatccgtc
tgtagcaccacatcctccaccccagcagccgtccctgggcagcagagtaagcggggtgcc
atgggctggcagaaggctgggcacccgccgtccgatggccaacagagagcaacacaacag
ggcactctcaggaccttgcttggcgatggcgttggcagacagcagccgcggaccaaacag
gtgtgcaatgtcgaggtgggtcttcagacccaggacaggccccctgctatgggagccaag
cacagcggcaatggccactgcgtgcagaactttcctccctccctggcttcgaaacccagc
cttgtccagcagaagcctactgcctatgtgcggcccatggatggccaagatcaggcgccc
gatgagtctccgaagctaaagtcgtctgcagagactggcgtgcactgcttgtacaggggt
gtcccggccaccaagtcagagtcagccagagccaaggccaagctctccaagttcagcatc
cccaaacaaggagaggagagtcgatctggagaaaccaacagctgtgttgaagaaatcatt
cgggagatgacctggcctccagcacttgctgctattcaaccacctggcaaagtggaacca
agcaaatttccatttccaaataaggactctcagcttgcctcctctggacacaataatcca
aagaaaggtgatgccgagccagagagtccagacaatggcacatcgaacacatcaatgcta
gaagatgaccttaagctaagcagcgatgaagaggagaatgaacagcaggcagcccagaga
acggccctccatgctctgtctgacagtgccggactccagccggccgactgcagggcctcc
gcaccctcgagcaagggcagcagcagcggcagcagcagcagtgggagcagctcctccagc
gactcggagagcagctcggggtccgactcggagacagagagcagttccagcgagagcgag
ggcagcaagcctccccactactccagtcccgaggcggaaccagcgtcctctaacaagtgg
cagctggataaatggctaaacaaagtgaatcaccacaagccccctgtcctgatccaaaat
gaaagccaccacgggccggagagcagtcagtactacaccccagtgaaggaggacacgcag
gactgcgggaagctccccgacgtctgcccgcccggcctgagagacaaggacatcaagggc
gcctgcaaggaggagcagaggcccaggaccgcgaacaaggcccccgggagcaaaggggtg
aagcagaagtccccgcccgcggccgtggccgtggccgtgaccgccgccgccgccccgccg
cccgcggtgcctggtgcgcccgccgagagcgcgcccgcacctgcccggaggtccgcgggc
aagaagcccacccggcgcaccgagaggacctcggccggcgacagcggccaccggcccgag
gagcccgtagctgccgaggcgctgggggcgagcacgggggttcccccggagccccccaag
ccccggccttgcggcaacagcaggaccaaccaccgcaaggagctgcgctcggccgtgacc
tgcgagaagcgccgcactcgggggctgagccggatcgtccccaagtccaaggagttcatc
gagacggagtcgtcctcttcctcctcctcctcggactcggacctggagtcggagcaggag
gactaccctctgtccaaggccgtggccgccgccgccgccgctgccgctgcctccgggaac
gacccaaggctgaaggaggctcccagcagcatcagcggcggcggcccccgcgctcccgtg
ggctccatcaacgccaggaccaccagcgacattgccaaggagctggaggagcagttctac
acactggtccccttcggccgcaacgagcttctctccccgttgaaggacagtgacgaggtc
cggtcactctgggtcaaaattgacttgacacttctgtccaggatcccggaacacctgccc
caggagccgggggtcttgagtgctccggcagccaaggactctgagagcgcgcccccgagc
cacgcatcggaggcgcccgtggaaaagaccttgccaaaatccaagaggaaacgcaagtgt
gacaacgaagacgattacagggagatcaagaaggccccgggagagagggagagcgcctca
cgactgagcgcctctgccaacagtactttgtctgcaaatcattgcagcatgaacatcaac
agcttggcaataccaataaataaaaatgaaaaagtgctccggtcgcccatctcacccctc
tccgacgcatctaaacacaaattctccggcgaggacttgacttcctccagcagatccaac
agcaacggtctgttcacctccacctcctccagcaaaaagcataaggcagagagccagctg
cagagccacgccgcggacctcacgaaagcggctcacaacaattccgaaaacattctccac
aagtcacggccgcagacagagccctggtctccaggctccaacggccaccgggactgcaag
aggcagaaactcatcttcgacgatatgccacgcagtgcagattattttatgcaagaagct
aagcgaatgaagcataaagcagatgcgatggtggaaaagtttggaaaggctctgaactat
gcagaagcagccttgtcattcattgagtgtggaaatgccatggaacagggccccatggag
tccaaatctccttacaccatgtattcagagacagttgagctcatcaggtatgccatgaga
ctaaaaacccactcaggtcccaatgccacaccagaggataaacagctggctgcattatgt
taccgatgcctggctctcctgtactggaggatgtttcgactcaaaagggatcacgctgta
aagtattcaaaagcacttatcgactatttcaagaattcatctaaagctgcccaagcccca
tctccatggggggccagtggaaagagcactgggaccccatcccccatgtctcccaatccg
tcccccaccggctccgtgggctctcaggggagcctgtccaacagcaacgccctgtcccca
tccaccatcgtcagcatcccgcagcgcatccaccagatggcggccaatcacgtgagcatc
accaacagcattctccacagctacgactactgggagatggcagacaacctggccaaggaa
aacagagaattcttccacgacctggacctgctcatggggccggtcaccctgcacagcagc
atggagcacctggtccagtactcccagcagggcctgcactggctgcgaaacagcgcccac
ctggcctag

DBGET integrated database retrieval system