KEGG   Bos taurus (cow): 788091Help
Entry
788091            CDS       T01008                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04218  Cellular senescence
bta04370  VEGF signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04722  Neurotrophin signaling pathway
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    788091 (MAPKAPK2)
   04370 VEGF signaling pathway
    788091 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    788091 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    788091 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    788091 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    788091 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    788091 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    788091 (MAPKAPK2)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     788091 (MAPKAPK2)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   788091 (MAPKAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Pkinase_fungal Choline_kinase
Motif
Other DBs
NCBI-GeneID: 788091
NCBI-ProteinID: XP_024832429
BGD-bta: BT24646
Position
16
AA seq 327 aa AA seqDB search
MKGHLPLQGCLQHSAWEMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAGRKCLLI
VMECLDGGELFSRIQDRGDQAFTERGRKEASEIMKSIGEAIQYLHSINIAHRDVKPENLL
YTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIM
YILLCGYPPFYSNHGLAISPGMKSRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQR
MTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIK
KIEDASNPLLLKRRKKARALEAAALAH
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggcaccttcctcttcagggatgtttgcagcactctgcctgggagatgctgcag
gactgccccaaggcccgccgcgaggtggagctgcactggcgcgcctcgcagtgcccgcac
atcgtgcgcatcgtggacgtctacgagaacctgtacgcggggcggaagtgcctgctgatc
gtcatggagtgtttggatggcggagaactgttcagtcgaatccaggaccgaggagaccag
gccttcacggaaagaggtagaaaggaggcctcagagatcatgaagagcattggcgaggcc
atccagtatttgcactcaatcaacatcgcccatcgggatgtcaagcccgagaacctttta
tacacctccaaaaggcccaatgccattctcaaactcactgattttggctttgccaaggaa
accaccagtcacaactctctgaccactccttgttacacgccatactacgtggctccagag
gtgctgggcccagagaagtacgacaagtcctgtgacatgtggtccttgggtgtcatcatg
tacatcctgctgtgtgggtacccccccttctattccaaccatggccttgccatctctccg
ggcatgaagagtcgcatccgaatgggccagtatgagttccccaacccagaatggtcagaa
gtatcagaggaagtgaagatgctcatccggaacctgctgaagaccgagcccacccagagg
atgaccatcaccgagttcatgaaccacccctggatcatgcaatcgacgaaggtccctcaa
accccactgcacaccagccgggtcctgaaggaggacaaggagaggtgggaggacgtcaag
gaggagatgaccagtgccttggccacgatgcgggtcgactacgagcagatcaagataaaa
aagattgaagacgcgtccaaccctctgcttctgaagaggcggaagaaagcccgggccctg
gaggccgcggcccttgctcactga

DBGET integrated database retrieval system